KEGG   Serratia sp. MYb239: CLM71_22600
Entry
CLM71_22600       CDS       T05477                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
serm  Serratia sp. MYb239
Pathway
serm00333  Prodigiosin biosynthesis
serm01100  Metabolic pathways
serm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:serm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CLM71_22600
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: AVJ19739
LinkDB
Position
complement(4732669..4735344)
AA seq 891 aa
MSNALVVELSGDQALEQHRLGGKAYSLNHLIQAGLPVPPAFCVTAQAYRQFIDDAVPATL
LNAGESGNVRDMILNASMSEPLSQAIRDACRRLGGDVSLAVRSSALEEDGLSQSFAGQYD
TYLHVNGADEVLRKVRSCWASLWAERAAQYSRVHAAQSDIAVVLQVMVDADAAGVMFTQD
PLTGDTDCVVIDSCWGLGEGVVSGQVTTDSFILDKASGALREQQVRHKSHYCQRNEQGQI
VLLHTPEAQRDAPSLNAEQLQRLVTLGRQARLIYGTELDIEWAVKDGQVWLLQARPVTVL
AKPAQGVYANPWEDSQAVRDRAFFSRMDTGEIVTGLMTPLGLSFCQFYQKHIHGPAIKTM
GLADISDWQIYMGYIQGYVYLNISGSAYMLRQCPPTRDEMKFTTRYATDDIDFSQYRNPY
GTGVQGWGYIKSSWYWLKQQVHNLRNAASIVEQMIALRQRETRRFLNLDLAAMSLQELND
ELQRIDGYFLESCAAYMPFFLQSFALYDALALTCERYLKGEGQGLQNRIKASMNNLRTIE
VTLGIIRLVDKIERQPALKTLFERHSAAELVTLLPEHTLARDFWQQDFSAFLLEFGARGR
QEFELSIPRWRDDPSYLLQVIKMYLQHPVDLQKKLRETEQLRQQDSEKLLRGMPWAGRLK
LKTLTKLYGVMAERREATRPTFITETWFYRCIIVEVLRRLEGQGLASAADLPYLDFERFR
AFMAGEMSAQEAFSPSLIDSNRHQHLLNLHAEEPPMAIIGAYTPKMKAHASGDAATDVLS
GLAASPGKVVAKARVITDLQAQVAEVQPNEILVARFTDASWTPLFAQAAGIVTDIGSTLS
HSCIVAREFGIPAVVNLKVATQVINSGDTLILDGDSGTVIIQPGEPPDAAA
NT seq 2676 nt   +upstreamnt  +downstreamnt
atgagcaacgcgttagtggttgaactgtctggcgatcaggcgctggaacagcatcgccta
ggtggtaaggcctactcgttaaatcatctgattcaggccggtctgccggtaccgcccgcc
ttctgcgtcaccgcgcaggcttaccggcaatttatcgacgatgcggtgcccgcaacgctg
ctgaacgccggtgaatcaggcaacgtgcgcgatatgattttaaacgccagcatgtctgaa
ccactcagccaggcgatccgggatgcctgccggcggctcggcggcgatgtgtcactcgcg
gtccgttcctcggcgctggaagaagacggcctgagccaatccttcgccggccaatatgat
acctatctgcacgttaacggcgccgacgaggtattgcgcaaagtgcgttcctgctgggcg
tcgctgtgggctgagagggcggcgcaatacagccgggtgcacgccgcgcaaagcgacatc
gccgttgtattacaggtgatggtcgacgccgacgcggctggcgtgatgtttacccaggac
ccgttaaccggcgacacggattgcgtggtgatcgacagctgttggggtctgggcgaaggc
gtagtgtccggtcaggtcaccaccgacagctttattctggataaggcgagcggcgcgctc
cgtgaacagcaggtccgtcataaatcccattattgtcagcgtaacgagcaggggcagatt
gtgctgctgcataccccggaagcgcaacgcgacgcgcccagcctgaacgcggagcaactg
cagcgtttggtcaccctcggcagacaggcacggctgatttacggcaccgagctggatatt
gagtgggcggttaaagacggccaggtatggttgctgcaggcgcgcccggtcacggtgctg
gccaaaccggcacagggcgtctacgccaatccttgggaagacagtcaggcggtcagggat
cgtgcctttttctcacggatggataccggcgaaattgtgaccggactgatgacgccgctg
gggctgtcgttttgtcagttctaccaaaagcacattcacggcccggcgatcaagactatg
gggctggccgatatcagcgactggcaaatctatatggggtatatccagggttacgtttac
ctgaatatttccggttcggcttatatgcttcggcagtgtccgccgacccgggatgaaatg
aagttcaccacccgctacgccaccgatgatatcgactttagccagtaccgtaacccttat
ggtaccggcgttcagggctggggatatatcaagagcagctggtactggctgaagcagcag
gtgcataacttgcgtaacgccgccagcattgtcgaacagatgatcgcgctgcgtcagcgc
gaaacccggcgctttctgaatcttgatttagcggcaatgtcgctgcaggagctgaacgac
gaactacagcgcatcgacgggtatttcctggaaagttgcgcggcctatatgcccttcttt
ctacagtcattcgccctctacgatgcgctggcgctgacctgcgagcgctatctcaaaggc
gaaggacagggactgcagaaccgcatcaaggcctcaatgaataatctgcgcaccattgag
gtcacgctgggcattatcaggctggtggacaagattgagcgtcagccagcgctgaaaacg
ttattcgaacgtcacagcgccgctgaactggtgacgcttctgccggaacatacgctggca
cgcgatttttggcagcaggattttagcgccttcctgctggagttcggcgcccgcggccgc
caggagtttgaactcagcattccgcgctggcgagacgatcccagttacctgctgcaggtg
ataaaaatgtacctccagcatccggtcgatctgcagaagaagctgcgggaaacggagcag
ctccgccaacaggacagtgaaaaactgttgcggggtatgccttgggcggggcggcttaaa
ctgaaaaccctgaccaaactgtacggcgtgatggcagaacgacgtgaggccaccaggccg
acctttattacggaaacctggttctaccgctgcatcatcgtggaggttctgcggcgtctt
gaggggcagggactggccagcgctgccgatttgccttacctggattttgagcgttttcgc
gcctttatggcgggggaaatgtctgcgcaagaggcgttttcgccgtcgttgatcgacagt
aatcgtcaccaacatctgctgaacctgcacgcggaagagccgccgatggcgatcatcggc
gcctacacgccgaaaatgaaggcgcatgcgtcgggtgatgcagcgaccgacgtcctgagc
gggctggcggccagcccgggaaaagtggtggccaaagcgcgggtgatcaccgatttgcag
gcccaggtggcagaggtgcaacccaatgagatcctggtggcgcgctttaccgatgccagc
tggacgccgttgttcgctcaggcggccgggattgtcaccgatatcggctcaaccctgtct
cacagctgtattgtcgcccgcgagtttggcattcccgccgtcgtcaatctgaaggttgcg
actcaggtgatcaacagcggtgacactctgatcctcgacggtgacagcgggacggtcatc
attcagcccggggagcctcccgatgctgctgcgtaa

DBGET integrated database retrieval system