KEGG   Serratia sp. ATCC 39006: CWC46_20640
Entry
CWC46_20640       CDS       T05968                                 
Name
(GenBank) prodigiosin biosynthesis protein PigM
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00333  Prodigiosin biosynthesis
serq01100  Metabolic pathways
serq01110  Biosynthesis of secondary metabolites
Module
serq_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CWC46_20640
SSDB
Motif
Pfam: DUF4840 DUF4123
Other DBs
NCBI-ProteinID: AUH02629
UniProt: A0A2I5TDK8
LinkDB
Position
complement(4520169..4521071)
AA seq 300 aa
MLMSCGIFFEYLSTLLKHSGYPLDWQWVGARQNGSSGMLISFAPSAPCVADLVAYQQWVQ
RISDRHTVRTAYQPTQVNEQQQAQLYALFDRSPVTCDIKYGEATRHDVAFLTANYASLDF
ADQQAWRETYHYIRFNEQQAAEDGFYLHHLFGPVSCGFRWFFRIAFHPRLSWLAKRLRLP
ASMAKGLAELVVEGPQYLALSLEHESDENLFIAGMKLGQLWLMLQSWGWSLHPLSVLVQH
ATARCALADTVRLTGLPVFFARFGQHRQSGIPTPRRAWQRILTTTQHSFSPENGADVKQP
NT seq 903 nt   +upstreamnt  +downstreamnt
atgctgatgagttgtgggatcttctttgaatacttgagtacgttgctcaagcattcaggc
tatccgcttgactggcagtgggtgggggcgcggcagaacggctcgagcggtatgttgata
tcgtttgcgccgagtgcgccatgtgtcgctgatctggtggcttatcagcaatgggtgcaa
aggatcagcgatcggcatacggtcagaacggcctatcagccgacacaggtgaatgaacaa
caacaggcacaactatacgcgttatttgaccgttcaccggtgacctgcgacatcaaatat
ggcgaagcaacgcgtcatgacgtcgcttttctcacggcaaactatgcatcgcttgatttt
gccgatcaacaggcctggcgggaaacctatcactatattcggttcaatgagcagcaggcc
gccgaagatgggttttatctgcatcatttgtttgggccggtatcatgcggatttaggtgg
tttttccggattgcgtttcaccccaggctaagctggctggcaaaacgattgcgattgcct
gcttccatggcgaaagggctagccgaactggtggtggaaggcccgcaatacctggcgttg
agtcttgaacatgagagcgacgaaaatctgtttatcgccggaatgaagcttggccaactg
tggctgatgttacagtcgtgggggtggagcttgcatccgctcagtgtgctggtgcagcac
gccactgcgcggtgcgctttggctgacactgtccggcttaccggcttaccggtttttttt
gcgcgttttggccagcaccgtcagtcgggaatacccactccaagacgcgcctggcagcgt
attttaaccacaacacagcatagtttctcccctgaaaacggggctgatgtaaaacaaccc
taa

DBGET integrated database retrieval system