KEGG   Serratia sp. ATCC 39006: CWC46_20680
Entry
CWC46_20680       CDS       T05968                                 
Name
(GenBank) aspartate aminotransferase family protein
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00333  Prodigiosin biosynthesis
serq01100  Metabolic pathways
serq01110  Biosynthesis of secondary metabolites
Module
serq_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CWC46_20680
Enzymes [BR:serq01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     CWC46_20680
SSDB
Motif
Pfam: Aminotran_3 DUF5587 AI-2E_transport
Other DBs
NCBI-ProteinID: AUH01991
UniProt: A0A2I5TP19
LinkDB
Position
complement(4529299..4531860)
AA seq 853 aa
MKFGFIAHPTSVGLKRYVKMIDLLQRNSTELHSGYKRDLWRRENLVPFMNFAKITSATGA
TCEGVIKYMPLVADEMLADARGIANRVVSGIEELVEDGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYKALMQIQSWLDIQPEQEPVAIVGYPGSICLALSRLLLAQGFS
LHLLHRAGHKDEDELLSHLPEQYRSRVTLTSDPEDLYPRCKLFVAATSAGGVIDPYKLQP
GSVFIDVALPRDINSDTRPDRDDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALENRRENFSLGRYLALDNVLEIGELAEKHGFLVYPLASYGERIDRQRVINLKRYYH
HDIYSDEPDTEQPPASQLAFIDAIIAQDPAREDTLDRYHQFINPMMVEFLKLQHCDNVFR
RASGTQLFTADGEAFLDMVAGYGCINLGHNPQPIIDALKAYLDAQGPNFIQYISIPEQAA
KLAEVLCHFAPGNMGRVFFSNSGTEAVEAAMKLAKASTGKAGIAYLKNSYHGKTLGALSI
TGREKHRRHFKPLLASMIEVPFADIEALRQTLSRDDIGALMIEPIQGEGGVHVPPPGYLR
TVQEICRQTDTLLMVDEVQTGLGRTGKLFACEWEGIEPDVLMLSKSLSGGVMPIGATLCR
ADIWQRAYGTADRFLMHSSTFGGGNIAAVVALSALREILAQDLVGNAERLGTYFKQALTD
VAARYPFVAEIRGRGLMLGIQFDQTFAGAVGASAREFATRLPGDWHTTWKFLPDPVQAHL
KAAMERMEQSLGEMFCMKFVTKLCQDHNILTFITANSSTVIRIQPPLTISKAEIDRFVSA
FATVCDELSTFLE
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgaagtttggatttatcgctcatccaacctcggttggtttaaaacgctatgtcaaaatg
attgatttattacagcgtaattcgacggagttgcatagcgggtacaaacgagacctttgg
cgccgggaaaacctggtccctttcatgaactttgccaaaattacctcagcgaccggcgct
acctgtgagggagtgatcaaatacatgccgctggtcgcggatgagatgctggctgatgct
cgcggcattgccaatcgtgtggtgtcgggtatcgaagaactggtcgaggatggcgctgaa
ctggtcggtttgggaggattcacctccattgtcgggcggcgtggtgaagccaccgccgag
aaatcaccggttccggtgacctccggtaattcgttaaccacctatgcgggttacaaagcg
ctgatgcagattcagtcctggctggatattcagccagagcaggagccggttgcgattgtc
ggctatccgggctccatctgtttggcgctgagccggttattgctcgcccagggtttttcc
ctgcatttgctgcatcgggccggccataaagatgaagacgaattgctcagccatttgccg
gagcaatatcgctcacgcgtcacgttgaccagtgatcccgaggatttatacccgcgttgt
aaactgtttgtcgccgcaacatccgccggaggcgtgattgacccgtataaactgcaaccg
ggttcggtctttattgatgtggcactgcccagagatatcaattctgacacgcgtcccgat
cgggacgacattttgattatcgacggcggctgcgttacggccaccgatgcggtcaaactg
ggtggtgagtcactgaacgtcaccattaaacagcaattgaatggctgtatggcggaaacc
attgttttggcactggaaaatcgccgggagaatttctcgttgggccgctatctggcgctg
gataacgtgcttgaaatcggggaacttgcggaaaaacatggtttcctggtctatccactg
gcctcttatggtgagcggattgatcgtcaacgggtgatcaatctcaagcgttactatcac
catgatatttattccgatgaacctgatactgaacaaccgccggcgtcgcagttagccttt
atcgacgcgattattgctcaggatcccgccagagaagacactctggatcgctatcatcag
ttcattaacccgatgatggtggaatttctcaaactgcaacactgtgacaatgtattccgg
cgggcctcgggtactcagctgtttaccgctgacggcgaagcctttctggatatggtggcc
ggttatggttgcatcaatctgggtcacaatccgcaaccgatcatcgatgctttaaaagcc
tatctcgatgctcaggggcccaattttattcagtatatttcgatccccgagcaagctgcc
aagttggccgaagtgctctgccatttcgcccctggcaatatggggagggtgttcttcagt
aattcagggacggaggcggtcgaggcggcaatgaagctggccaaagcgtcgacgggcaaa
gccggcattgcgtatctgaaaaatagctaccatggcaaaacgctgggcgcgttatccatt
accggacgagaaaaacaccgccgtcattttaagccactgctggcgtcgatgattgaagta
ccgtttgctgatattgaggcactgcggcagaccttaagccgtgatgacatcggcgcgttg
atgatcgaaccgattcagggtgaaggcggggtccatgttcctccgcctggatacctgcga
accgttcaggagatctgccgtcaaaccgataccttactgatggttgacgaagtgcaaacc
gggttggggcgcaccgggaagctctttgcctgtgagtgggaagggatcgagccggatgta
ctgatgctatcgaaatcactgtccggcggggtaatgcctattggcgccacgctatgtcgg
gccgatatttggcaacgggcctatggcaccgcagaccgctttttgatgcacagctcgacc
tttggcggcgggaatatcgcggcggtagtggcgctcagtgcgttaagagaaattctggct
caggatctggtcgggaacgccgagcgactaggcacgtactttaagcaggcgcttaccgat
gtcgctgcccgatacccctttgtggcggaaatacgcggacgcggcttgatgttagggatc
cagttcgatcaaaccttcgctggtgccgtaggtgcttcggcccgggagtttgccacccga
ctgcccggtgactggcacacgacatggaaattcctgcctgatccggtacaagcccactta
aaggcggcgatggagcgtatggaacaatcactgggtgaaatgttctgcatgaaatttgtg
accaagctttgtcaggatcacaacattctgacctttattaccgccaacagctcaaccgtt
attcgaattcaaccgccactgaccatcagcaaggctgagatcgatcgttttgtcagtgcg
tttgccacggtgtgcgatgagctatcaacatttttagagtaa

DBGET integrated database retrieval system