KEGG   Serratia sp. ATCC 39006: CWC46_20690
Entry
CWC46_20690       CDS       T05968                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
serq  Serratia sp. ATCC 39006
Pathway
serq00333  Prodigiosin biosynthesis
serq01100  Metabolic pathways
serq01110  Biosynthesis of secondary metabolites
Module
serq_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:serq00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    CWC46_20690
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: AUH01993
UniProt: A0A2I5TBR6
LinkDB
Position
complement(4534620..4537292)
AA seq 890 aa
MNQPLVVEISGDKALEHHHLGGKGYSLNNLIHAGLPVPSAFCVTAQAYQQFIEEVVPGAE
LTDGDLIAVRDAILHADIPDSLKQAIGDAYQHLGHDTTIAVRSSALDEDGQRQSFAGQYE
TYLHVKGSEAVLHKVQACWASLWAERAAQYRHESASHSAIAVILQVMVDADAAGVMFTQD
PLSGSTDKVVIDSCWGLGEGVVSGQVTTDSFTLDKATGELCDQQIRHKPNYCQRDEHGLV
TLLQTPEAKRDLPSLTPAQLQQLVTLARQAQLIYSTELDIEWAVKDDKVWLLQARPVTTS
AKTANVIYANPWESDPAAKEGAFFSRMDTGEIVTGLMTPLGLSFCQFYQKHIHGPAIKTM
GLADISHWQIYMGYIQGYVYLNISGSAYMLRQCPPTRNEMKFTTRYATDEIDFKDYKNPY
GAGVQGWDYAKSCWYWLKQQVRNMRSAARTVEQMIALRQDETTRFLGLDLTAMTLQQLDQ
ELQRIDRFFLDSCAAYMPFFLQSFALYDALAQACERHIKDGKGLQNRIKASMNNLRTIEV
TLGIIKLVATVNQQTELKALFEQHRADELVTLLPVHDISRAFWQGDFEDFLVEFGSRGRQ
EFDLSIPRWRDDPSYLLQVMKMYLQHPVDLHKKLRETELLRQQDSEALFSAMSWSGRFKL
KTLIKLYGMMAERREATRPTFITETWFYRCIMLEVLRRLDAQGIASSADLPYVDFEQFRA
YVAGTIPAEQAFSKARLDQNRHQHLFNLHAEEPPMAIVGPYTPKVKAPTQDDKTIRSLTG
LAASPGNVVAKARVITDLQVQAGEFQPDEILVARFTDASWTPLFALAAGIVTDIGSTLSH
SCIVAREFGIPAVVNLKTATQIINSGDMLILDGDSGTVIIQHQEERNHDG
NT seq 2673 nt   +upstreamnt  +downstreamnt
atgaatcaaccactggttgttgaaatatccggtgataaggcgcttgaacatcaccacttg
ggcggtaagggttattcactcaacaacctgattcatgcgggcctgccagtaccttcggca
ttttgtgtgacggcacaagcctaccaacagtttattgaagaggtggtgccgggggcggaa
ttaactgacggcgacctgattgcggtgcgtgacgccatcctgcatgccgatattcccgac
tcgctaaagcaggctatcggtgatgcttatcaacacctgggccatgacacgaccattgcg
gttcgttcttcggcattggatgaagatggtcaacgtcagtcatttgccgggcagtacgag
acttacctgcatgtgaagggttcagaggcagtgttgcacaaggttcaggcttgttgggcg
tcgctttgggctgagcgagcggctcaatatcgtcatgaatctgcgtcgcacagtgccatt
gccgtgattctacaagtgatggttgatgccgatgcagcgggagtgatgtttactcaggat
cctctgtcagggagcaccgataaggtggtgattgacagttgttgggggctgggggaaggc
gtggtttccgggcaagtcaccacagatagtttcacgctggataaagccaccggtgagcta
tgtgatcagcagattcgccacaaaccgaattactgccagcgggacgaacatggtctggtg
acactgttgcaaaccccggaggccaaacgggatctccccagtctgacgccggctcagttg
caacagttggtcacgctggccagacaggcccagcttatctacagcaccgaactggatatt
gaatgggcggtgaaagatgacaaagtctggttattacaggcgcgtccggtaaccacatcg
gccaaaacggctaacgttatctacgccaatccgtgggagagcgacccggctgcgaaggag
ggcgcttttttctcgcggatggataccggagagattgtgacggggctgatgacgccactg
gggttgtcattttgtcagttctatcaaaagcacattcatggcccggccatcaagaccatg
gggcttgccgatattagtcactggcagatctatatgggctatatccagggctatgtttat
ctgaatatttccggttcggcctatatgctcaggcagtgtccaccgacccgtaatgaaatg
aagttcaccacccgctatgccacggacgagatcgattttaaggactataaaaacccctat
ggtgcaggcgtgcagggctgggattatgccaagagttgttggtactggctaaaacagcaa
gtccgtaatatgcgcagcgccgccaggaccgtcgagcagatgattgccctgcgtcaggac
gaaaccacacggtttctggggcttgatttgaccgccatgacgcttcagcagttggaccaa
gagctgcaacggattgaccgctttttcctcgatagctgtgcggcgtatatgccttttttc
ctgcaatcatttgccctttacgatgcgctggcgcaagcctgtgaacgccatatcaaggat
ggtaaaggtctgcaaaatcgcatcaaggcgtcaatgaataacctgcgcacgatcgaagtg
acgctcggtatcatcaaattggttgcgacagttaaccaacagactgaattaaaagcgtta
tttgaacagcatcgtgccgatgagttagtcaccttgctacctgtccatgacatatcccgt
gctttctggcagggtgattttgaagattttctggttgaatttggttctcgcggtcgccag
gagtttgatctgagtatcccgcgttggcgtgatgacccgagttatttattgcaagtaatg
aagatgtatttgcaacacccggtagatttgcacaagaagctcagggaaacggaactgctg
cgtcagcaggatagtgaagcactgttcagtgcgatgtcctggtcgggccgtttcaagctc
aaaaccctcatcaagctgtatggcatgatggccgaacgtcgtgaagcgacgcggccaacg
tttatcaccgaaacctggttctaccgttgcatcatgctggaagttctacggcgtctggac
gcgcaggggattgccagtagtgccgatctgccctatgtcgattttgaacagttccgtgcg
tatgtggcggggaccatcccagctgaacaggcgttttccaaagcgcggctcgatcagaat
cgccatcaacatttattcaatttacatgccgaagaaccgccgatggcgattgtcggtccc
tatacccccaaagtgaaagcacccacgcaggatgataaaaccatccggtcactcactggc
ctggcggccagtcctggcaacgtagtggccaaagcgcgggtgattactgacttgcaggtc
caggccggtgagttccagccagacgaaattctggttgctcgttttaccgatgccagttgg
acgccgttatttgccctggcggccggtattgtcacggatattggttccacactttcacac
agttgtattgtcgcgcgtgagtttgggatccccgccgtggtgaacctgaaaaccgccacc
cagattatcaatagtggcgacatgttgatccttgatggagatagcgggacggtcattatc
caacaccaagaggagcgcaaccatgacggttaa

DBGET integrated database retrieval system