KEGG   Saccharomyces eubayanus: DI49_3053
Entry
DI49_3053         CDS       T08138                                 
Name
(RefSeq) TAH11-like protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
seub  Saccharomyces eubayanus
Pathway
seub04111  Cell cycle - yeast
seub04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:seub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    DI49_3053
   04113 Meiosis - yeast
    DI49_3053
SSDB
Motif
Pfam: CDT1_C
Other DBs
NCBI-GeneID: 28932190
NCBI-ProteinID: XP_018221348
UniProt: A0A0L8RGU1
LinkDB
Position
X:506055..507935
AA seq 626 aa
MAAVSEVGVGVASEASSECCDMSGKENSRRRTPLRVPVIDLDRVSAEDQLLPVVRAVLQQ
HDTFLLKNYANKAALDELLGALATTDLPDTSQGFDANFTGTLPLEDDVWLEQYIFDTDPQ
LHFDRACKNESLRSIYARLFKLGVFFAQLCVKGVVSSAELQDCISSTHCATKLTRYFNDG
DSAQNGLDPSATMLPNGDDFQYQFERDYVTLLPTGVLTVFPCAKGLRYKPSTMAATDNSW
VTVDEPDCLLFHTGTLLARWSQGMHTTSPLQVDPRANVVSLTIWPPLTTPIDDEGTIASH
LLEQQIKTFPKVAQQYYPREQNILKLQDAMKFVKELFSVCETILSLNALSRSTGVSPELH
VLLPQMSNMXKRKIVQDDVLKLLTIWSDAYVVELXSRGELTMTLPRRDNLMTLTNKSRTL
AFVEKAESWYQQLIASNNDIITDIPVFKINKRRASINNKTIMGSKAQTKNSNSNALNNSK
YLSNKKENFFYKEKTPDSQANLLDRLRERERRSAALLSQRQRHYQQFLAMKMTQVFDILF
SLTSGQPYTETYLGSLVVDSLQDSNNPIGSKEASEILAGLQGILPMEISVHQVDGGLKVY
RWNSLDKNRFSKLLEIYKLKQQDDDV
NT seq 1881 nt   +upstreamnt  +downstreamnt
atggctgctgtcagtgaagttggtgttggtgtggccagcgaagcaagctcagagtgttgt
gatatgagcggtaaggagaatagcagaagaagaacgccgctgcgtgtgccggttatagac
ctggaccgggtttccgccgaagaccagctgttgccggtggtgagggccgttttgcagcag
cacgatacgttcctgttgaagaactatgccaacaaggcggcgctggacgagctgctgggg
gcgcttgcgacgactgacctgcccgacacgagccaagggttcgatgcgaacttcacaggc
acgctgccgctcgaggacgacgtctggctggagcagtatatcttcgacaccgatccgcag
ttgcacttcgaccgggcatgcaagaacgagtcgctgcggtcgatttacgccagactgttc
aagctgggcgtgttcttcgcgcaattgtgtgtgaaaggtgtggtctcgagcgctgagttg
caggactgcatctccagcacacactgtgccacgaagctcactcgttacttcaaygacggt
gacagcgcacagaacggcttggacccgagtgccacgatgcttcccaacggcgacgatttc
cagtaccaatttgagagggactacgtcactttgctgccgacgggtgtgttgaccgtgttc
ccctgtgccaagggcctcaggtacaagccctcgacgatggcagccactgacaactcttgg
gtgaccgtcgatgagcccgactgtctgctgttccacacggggaccctgctggcgcgctgg
tcccagggaatgcacacgacttcaccgctccaggtagaccctcgtgcgaacgtcgtgtcg
ttgaccatctggcctccgctgacgacgccgatcgacgatgaaggcaccattgccagccac
ttgctggagcaacagatcaaaacgttcccgaaggtcgctcagcagtactacccgcgagaa
cagaatattctgaaactgcaagatgctatgaagttcgtcaaggagctgttcagcgtgtgt
gagaccatcttgtctttgaatgcgctctccaggtccaccggggtttctcctgagctgcac
gttttgctgcctcagatgtctaacatgatraaaagaaaaatagtgcaagatgacgtgttg
aagctgttgaccatttggtccgatgcatacgtggtcgagctgarctcaagaggcgagttg
acgatgactttgcccaggagagacaacctgatgacgttgacgaataagtccaggacgttg
gccttcgtggagaaggcagagtcgtggtaccaacaattgatagcttccaataacgacatt
attacagatatacccgtcttcaagataaataaaagaagagcaagcatcaacaacaaaacc
attatgggcagcaaggcgcaaacgaaaaattccaactccaatgcgcttaacaactctaaa
tacctatcgaataagaaggaaaacttcttttataaagagaaaacccctgattcgcaagcc
aaccttttggaccggctacgtgaaagggagagacgttcagctgcactgctttcgcaaaga
caaagacattaccagcagtttctagcgatgaaaatgacccaggtgtttgatattcttttc
tcattgacttcgggacagccttatacggaaacttacctaggttctttggtcgtggacagt
ttacaagacagtaacaaccctattggttcgaaagaagcaagcgaaattctggccgggctg
cagggaattctaccaatggaaatatctgttcatcaagtggacggtggattgaaagtttac
agatggaacagcttagacaaaaacagattctccaaattattggaaatttacaaactaaaa
caacaagatgatgatgtttag

DBGET integrated database retrieval system