KEGG   Saccharomyces eubayanus: DI49_5271
Entry
DI49_5271         CDS       T08138                                 
Name
(RefSeq) DDC1-like protein
  KO
K06663  DNA damage checkpoint protein
Organism
seub  Saccharomyces eubayanus
Pathway
seub04111  Cell cycle - yeast
seub04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:seub00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    DI49_5271
   04113 Meiosis - yeast
    DI49_5271
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:seub03400]
    DI49_5271
DNA repair and recombination proteins [BR:seub03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    DI49_5271
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 28934407
NCBI-ProteinID: XP_018218844
UniProt: A0A0L8R9N0
LinkDB
Position
XVI:159990..161807
AA seq 605 aa
MSFRATITDPGKQNIWFRAIYVLSTIQDDIKITVTTNELIAWSMNETDTTLCQIRFEKSF
FEGYEFKPHEIVFGENGIQVIDDTYGDNHKLYSFRVNGKHLTTISRKPDSDGIKSFTIAV
NNTSTCPESLANRLIVVIEMDSLIVKEYCPQFQPIKYDPIIIDLKYKRKFLDVFGTAASD
RNPQEPLDPKLLEVFVSTERELTSALFNEDVESDIRKRNQLTAADEINYVCCSSTLLKNF
LDNCNVNVTDEVKLEINVHKLSITAFTKAVYGKNNDLLRNALSMSNTISTLDLEHYCLFT
TVDDEKEEKRSHSKRKEHTKSIVFKLKDFKNFITISPSWKSSQGGNDNISLWFCHPGDPI
LMQMQKPGVKLELVEVTDSNITDDSMGGKYIKAAISGPKEETGKQEVKEGYESPLRSRIA
LHRETQSTSVTSTRKSPLKTSSLVPGSGNAVTKSYRNNTAKKLFVEEQSQTMSYGGKSLF
EQDILVNTNVNKERILKGSEAYQSNALKRSRNDIRNGAEDASQESTVAKRADTTVTWGRT
LPTSDDGVSSNEVNKREMLKREKLKHLQGLMHSRNGSNNNKSQDDKEEEGGLGPTQVEKP
RGLFD
NT seq 1818 nt   +upstreamnt  +downstreamnt
atgtcattcagggcaaccatcacagatccggggaagcagaatatctggtttcgtgcgatt
tatgttctatctacaattcaagatgatatcaagattactgtgacgacaaatgagttgatc
gcgtggtcaatgaatgaaactgataccacgctttgtcagatcagatttgagaagagtttt
tttgaaggatacgaatttaagcctcatgaaatcgtgtttggggagaatgggatccaagtc
atagacgatacgtacggtgataaccataaactatattccttccgagttaatggaaagcac
ttgacaactatttcgagaaagccagacagcgacggcataaaatcattcactattgcagtc
aataatacttctacatgtcctgagtcgctcgcaaataggttgattgtagtaattgaaatg
gattcgttgatagtaaaagaatactgtcctcagtttcagccaattaaatatgatcctatt
ataatcgatttgaagtacaaaagaaaatttttggacgtttttggaaccgcagcttccgat
cggaatccgcaagagccgttggaccctaaactattggaggttttcgtaagtactgaacgt
gaactaacatctgctctatttaatgaagatgttgaatcagacatacggaaaagaaatcaa
ctaacagctgctgacgaaataaattacgtctgttgcagctcaacactgttaaaaaacttt
ctagataactgcaatgtaaacgtgactgacgaggtaaaactagaaattaacgtccacaag
ttgagcataacagcatttactaaagcagtgtacggaaaaaataatgacctattgagaaat
gcattaagtatgagcaacactattagcacattagaccttgaacattactgcctcttcaca
accgtagacgatgaaaaagaagagaagcgatcacatagcaagcgtaaagaacatacaaaa
agcattgtttttaagctaaaagacttcaaaaactttataaccattagcccatcctggaaa
agttcacaaggtggaaatgacaatataagtttatggttctgtcatccaggagatcctatt
ctgatgcaaatgcagaagccaggtgtgaagctagaattagttgaagttaccgatagtaac
atcaccgatgattcaatgggagggaagtatataaaggcagccatttcgggccccaaagaa
gaaaccggaaagcaagaagtcaaagaagggtatgaaagcccgctaaggagtaggattgcg
cttcatagagaaacccagtcaacttccgtcactagcactcggaagagtcctctaaaaaca
tcatctcttgtcccaggtagtggtaatgcggttaccaagagctatagaaataacacggca
aagaagttatttgtagaagagcagagccaaactatgagttacggaggaaagagcctgttc
gagcaggacattttggttaatacaaatgtgaataaggaaaggattcttaaaggtagtgaa
gcttaccagtctaatgcgttgaagaggtctagaaacgatattcgtaatggagccgaagat
gcttcccaagagtcaaccgtcgcaaaaagagccgataccacagtgacttggggaagaaca
ttaccaacttcggatgacggggtttcgtccaacgaggtcaacaagagagaaatgctaaag
agagagaaactaaagcatttacagggtctgatgcattctagaaatggttcaaataataac
aaaagtcaggacgataaggaagaggaaggcgggctgggccctacgcaagttgagaagcca
aggggtttgttcgattga

DBGET integrated database retrieval system