KEGG   Streptomyces ferrugineus: IM697_30910
Entry
IM697_30910       CDS       T07428                                 
Name
(GenBank) phosphoenolpyruvate-utilizing enzyme
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
sfeu  Streptomyces ferrugineus
Pathway
sfeu00333  Prodigiosin biosynthesis
sfeu01100  Metabolic pathways
sfeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfeu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    IM697_30910
SSDB
Motif
Pfam: PPDK_N PEP-utilizers
Other DBs
NCBI-ProteinID: QOV34509
UniProt: A0A7M2SET7
LinkDB
Position
complement(6879201..6881927)
AA seq 908 aa
METRTDSIPAPAPATTVSQAPHADLVIALGRTGATVETAGGKAARLGEMIEAGLPVPPAF
CLSTGLFDLFLRETGLAAEIRAAEARGADSRTIRELIVDREMPESIARTVLAAYEDLGRP
RVAVRSSACREDSAAQSFAGQHDTVLDVSGDQSLLEAVKTCWASLWSDRAAAYRDSGSAG
SIAVVVQEMVHADVSGVLFTVDPVGGQPNRLVVEACCGLGEGLVSGRVSSDFFAVDDRTL
EVVEERVRYKVTKCASVTPGTIGMTKVDAADRNTPCLTREQLTALARLALDVRAHYDAEQ
DIEWALRDGTLYLLQTRPITTLPRENAAEAKRSPYVAPQPDAVRQGTLWSRMDIGEIFVG
LMSPLGLSFARYYQEHVHRDCAAALGVRDTGDVDLHMGYLQGHVYLNISYTAYLLGQCLP
TRDQRHFTSRFVSEEADLSSYENPFGTFPGGIDDLLSTLHWAQSTATEMLTMKHRAEEMV
ATRLYEFDRARRLDLTRMSRRELNAELIRYLDFFHDAHVGYMPYYINAFGFYGVLTELCR
KWLGADGDNLQNRLKTDMSSLRTVASAQEIWKVAQAARARPRVMKIIDEAPLEQIARRLR
DDDEGRAFWNAEMEPFLRANGTRGRQEMELTHPRWIDDPSYIFQMIRRYAADGFSVDDIM
GRSRARVEGDARSALEKLPLPQRKTLETVIAMYSLCSELRETTRMSMITSIWLVRNVVYE
VGRRLHAEGVLHSLDEVAYLDFDDVRTYLAGTRTGREAFSRAELDERRRAHDYHNRLPEP
PLTFIGEHDPTRSVRPAAGGTRLEGLGSSPGRIVGRARIVEDLVWQADEFQPGEILVTRY
TDASWTPLFAIAGGVVTDVGSMLSHSSIVSREFNVPSVVNTKYATQRINTGDMVMVDGDT
GVAEVVEG
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggaaacccgaaccgacagcatcccggcccccgccccggccacgacggtctcgcaggcg
ccgcacgcggacctggtgatcgccctcggccgcaccggtgccaccgtcgagacagccggg
ggcaaggccgcccggctgggcgagatgatcgaagccggccttccggtcccgcccgccttc
tgtctgagcaccggtctgttcgacctcttcctgcgcgagaccggtctggcggccgagatc
cgcgccgccgaggcgcgcggcgcggacagccggaccatccgtgaactgatcgtcgaccgg
gagatgcccgagtccatcgcccggaccgtcctcgccgcctacgaggacctgggccgcccg
cgggtcgccgtccggtcgtccgcctgccgggaggactccgccgcccagtcgttcgccgga
cagcacgacaccgtcctggacgtctcaggcgaccagtcactgctggaggcggtcaagacc
tgctgggcctcgctctggtcggaccgcgccgcggcctaccgggacagcggctccgcgggc
tcgatcgccgtggtcgtgcaggagatggtccatgccgacgtcagcggtgtgctgttcacc
gtcgatccggtcggcggacagcccaaccggcttgtcgtggaggcctgttgcggcctgggg
gagggcctggtgtccgggcgggtctccagcgacttcttcgccgtcgacgaccgcacgctg
gaggtggtcgaggagcgcgtccgctacaaggtgaccaagtgcgcctccgtgaccccgggc
accatcggcatgaccaaggtcgatgccgccgaccgcaacaccccgtgcctgacacgcgaa
cagctcacggcgctcgcccggctcgccctcgacgtccgcgcccactacgacgccgagcag
gacatcgagtgggccctgcgggacggcacgctgtatctgctgcagaccaggccgatcacc
accctgccccgggagaacgcggccgaggcgaagcgcagcccctacgtcgcaccgcagccg
gacgcggtgcggcagggcacgctctggtccaggatggacatcggcgagatcttcgttggc
ctgatgtcaccgctgggcctgagcttcgcccgctactaccaggagcacgtgcaccgcgac
tgcgccgccgccctcggcgtccgcgacaccggcgacgtcgacctgcacatgggctatctc
cagggccacgtctatctgaacatctcctacaccgcctatctgctgggccagtgcctgccc
acgcgcgaccagcgccacttcaccagccgtttcgtcagcgaggaggccgacctctccagc
tacgagaaccccttcggcaccttccccggcggcatcgacgacctcctgtccaccctccac
tgggcgcagtcgacggccaccgagatgctgaccatgaagcaccgcgccgaagagatggtc
gccacccggctgtacgagttcgaccgtgcccggcgactggacctcacccggatgagccgc
cgcgagctcaacgccgagctcatccgctacctcgacttcttccacgacgcacacgtgggc
tacatgccctactacatcaacgcgttcggcttctacggagtcctgacggagctctgccgg
aagtggctcggggccgacggcgacaacctgcagaaccgtctcaagaccgacatgtccagc
ctgcggaccgtggcatccgcgcaggagatctggaaggtcgcccaggccgccagggcccgg
ccgcgggtcatgaagatcatcgacgaggcgccgctggagcagatcgcgcggcggctgcgc
gacgacgacgagggccgcgccttctggaacgccgagatggaaccgttcctgcgggccaac
ggcacacgcggccggcaggagatggagctcacccatccgcgctggatcgacgacccctcg
tacatcttccagatgatccgccgctacgccgccgacggattctccgtcgacgacatcatg
gggcgcagccgggcccgggtggagggcgacgcccggtcggcgctggagaagctgccgctg
ccccagcgcaagacgctggagacggtcatcgccatgtactccctgtgcagcgagctgcgc
gagaccacgcgcatgtcgatgatcacgtcgatctggctggtcaggaacgtggtgtacgag
gtcgggcgcaggctgcacgcggaaggcgtcctgcactccctggacgaggtcgcgtacctc
gacttcgacgacgtccggacctacctcgccggtacccgcacgggccgcgaggcgttctcc
cgcgcggaactggacgagcgtcggcgcgcgcacgactaccacaaccgactgcccgagccg
cccctgacgttcatcggcgagcacgacccgacccggtcggtgcgacccgcggccggcggg
acgcgcctggaaggactgggctccagtccgggacggatcgtcggacgggcccgcatcgtg
gaggacctggtctggcaggcggacgagttccagccgggagagatcctggtcacccgctac
accgacgcctcctggacaccgctcttcgccatcgccggcggcgtggtcaccgacgtcgga
tcgatgctctcccacagttcgatcgtgtcgcgggagttcaacgtgccgtcggtggtcaac
accaagtacgccacacagcgcatcaacacgggcgacatggtcatggtcgacggcgacacc
ggtgtcgccgaggtcgtcgaaggctga

DBGET integrated database retrieval system