KEGG   Streptomyces ferrugineus: IM697_30920
Entry
IM697_30920       CDS       T07428                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
sfeu  Streptomyces ferrugineus
Pathway
sfeu00333  Prodigiosin biosynthesis
sfeu01100  Metabolic pathways
sfeu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sfeu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    IM697_30920
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Hydrolase_4 Abhydrolase_3
Other DBs
NCBI-ProteinID: QOV34511
UniProt: A0A7M2SH35
LinkDB
Position
complement(6883026..6883904)
AA seq 292 aa
MPITERPPGPATAPRPPAVGWFPGLTPASGAHAAPLRLICFPYAGGTPSVYRGWDAPLGA
GVQVVPVLLPGRGLRMRERPYSAMGPLVRDIAEALVQGELAHDYALFGHSMGALLAYEVA
CELRDRGHSAPRHLFVSGSRAPHLYGDRDDRTLSDADLRQLVAALGGLGDDHTIGSAYLD
RRLPVLRADLTVCEEYRWVPRAPLDCPMTAFSATRDPIAPRPSVEAWRSYTSGSLLHHHL
EGDHFFLSGLSRPSLLREIRSELARLTDEPGRPAPDAPDRLPTAKREPSWIC
NT seq 879 nt   +upstreamnt  +downstreamnt
gtgcccatcaccgagcggccgccggggcccgccacggccccgcggccacccgccgtcggc
tggttcccggggctcacgcccgcgagtggagctcatgccgcgccgctacgactgatctgc
ttcccgtacgcgggcggcactccctccgtgtaccgcggctgggacgccccgctgggtgcg
ggcgtgcaggtcgtccccgtcctgctgcccggtcgcggtctgcggatgcgcgagaggccc
tactccgccatgggaccactggtccgcgatatcgcggaagcgctggttcagggtgaactc
gcccatgactacgccctgttcggccacagcatgggcgcgcttctcgcctacgaggtcgcc
tgcgagctgcgcgatcgaggacacagcgcccctcggcacctgttcgtgtccgggagcagg
gcgccccacctctacggcgaccgcgacgaccggacgctgtccgacgcggacctgcggcag
ttggtggccgccctcggcggcctcggcgacgaccacaccatcggcagcgcctacctggac
cgtcgactgccggtgctgcgcgccgacctgacggtgtgcgaggagtaccgctgggtaccg
cgggccccgctggactgtcccatgaccgcgttctcggccacccgcgaccccatcgcgccg
cgaccctccgtggaggcgtggcggtcgtacaccagcggctccctcctccaccaccacctg
gagggcgaccacttcttcctcagcggcctctcgcggccgtcactcctgcgcgagatacgg
agcgaactcgcccggctcaccgacgagccgggcaggccggccccggacgcgccagaccga
ctccccactgcgaagagggaaccctcatggatctgctga

DBGET integrated database retrieval system