KEGG   Streptomyces formicae: KY5_8016c
Entry
KY5_8016c         CDS       T05416                                 

Name
(GenBank) Agmatinase
  KO
K12676  proclavaminate amidinohydrolase [EC:3.5.3.22]
Organism
sfk  Streptomyces formicae
Pathway
sfk00331  Clavulanic acid biosynthesis
sfk01100  Metabolic pathways
sfk01110  Biosynthesis of secondary metabolites
Module
sfk_M00674  Clavaminate biosynthesis, arginine + glyceraldehyde-3P => clavaminate
Brite
KEGG Orthology (KO) [BR:sfk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    KY5_8016c
Enzymes [BR:sfk01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.22  proclavaminate amidinohydrolase
     KY5_8016c
SSDB
Motif
Pfam: Arginase
Other DBs
NCBI-ProteinID: ATL33034
UniProt: A0A291QND6
LinkDB
Position
complement(9440098..9441048)
AA seq 316 aa
MDRIDTTVSPRYAQLPTFMRLPHDPKPRGKDVVVIGAPYDGGTSYRPGARFGPRAIRNES
GLIHGVGIDRGPGTFDLIDCVDAGDIDLTPFNMHIAMATAQERLSGLLTDNAAFLMLGGD
HSLTLAALRAVADLHGPLAVLHLDAHSDTNPAFYGGEYHHGTPFRHAIEEKLVDPRRMAQ
IGIRGHNPRPDSLDYARGHGVRIVTCDEFCSLGPERTGELVRDLVGEAPVYVSVDIDVMD
PAFAPGTGTPAPGGLTSREVLALLRGIGELRPVGFDVMEVSPLYDHGGITSVLATEIGAE
LLFQYARAHSRERTPS
NT seq 951 nt   +upstreamnt  +downstreamnt
gtggatcgcatcgacacgaccgtctcgccgcgctacgcgcagctccccacgttcatgcgc
ctgccgcacgacccgaagcctcggggcaaggacgtcgtcgtcatcggcgccccctacgac
ggcggcaccagctaccggcccggcgcgcgcttcggtccgcgcgccatccgcaacgagtcc
ggactcatccacggcgtcggcatcgaccgcgggcccggcaccttcgacctgatcgactgc
gtcgacgccggggacatcgacctgaccccgttcaacatgcacatcgccatggccaccgcc
caggagagactgagcggcctcctcacggacaacgccgccttcctgatgctcggcggcgac
cactcgctgacgctggccgcgctgcgcgcggtcgcggacctgcacggtcccctcgccgtc
ctgcacctggacgcgcactccgacaccaaccccgccttctacggcggcgagtaccaccac
ggcacgcccttccggcacgccatcgaagagaagctcgtcgatccgcggcggatggcgcag
atcggcatccggggccacaacccgcggcccgactcgctcgactacgcccgcggacacggc
gtacggatcgtcacctgcgacgaattctgctcactgggccccgagcgcaccggcgagctg
gtccgcgacctggtcggtgaagcgcccgtctacgtgtcggtggacatcgacgtcatggac
cccgcgttcgcccccggcaccggcacgcccgcgccgggcggcctcacctcgcgcgaggtg
ctcgccctgctgcgcggcatcggcgagctgcgcccggtgggcttcgacgtcatggaggtc
tcgccgctgtacgaccacggcggcatcacctccgtgctcgccaccgagatcggcgcggag
ctgctgttccagtacgcccgcgcgcactcccgagaaaggacaccctcatga

DBGET integrated database retrieval system