Sorex fumeus (smoky shrew): 130041528 Help Entry 130041528         CDS       T10594                                  Symbol MAX Name (RefSeq) protein max isoform X1   KO K04453   Max protein Organism sfum  Sorex fumeus (smoky shrew) Pathway sfum03083   Polycomb repressive complex sfum04010   MAPK signaling pathway sfum05200   Pathways in cancer sfum05202   Transcriptional misregulation in cancer sfum05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:sfum00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     130041528 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     130041528 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     130041528 (MAX)    05202 Transcriptional misregulation in cancer     130041528 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     130041528 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:sfum03000]     130041528 (MAX)    03036 Chromosome and associated proteins [BR:sfum03036]     130041528 (MAX) Transcription factors [BR:sfum03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     130041528 (MAX) Chromosome and associated proteins [BR:sfum03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      130041528 (MAX) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  HLH bZIP_2 JetA Filament TPR bHLH_SAC51 bHLH_INO4 SlyX PUMA_CC ANG-1 DUF7801 GAGA_bind SLX9 DUF4763 Csm1_N Motif Other DBs NCBI-GeneID:  130041528 NCBI-ProteinID:  XP_055989731 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MSDNDDIEVESDEEQPRFQSAADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASR AQILDKATEYIQYMRRKNHTHQQDIDDLKRQNALLEQQVRALEKARSSAQLQTNYPSSDN SLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgagcgataacgatgacatcgaggtggagagcgacgaagagcaaccgaggtttcaatct gcggctgacaaacgggctcatcataatgcactggaacgaaaacgtagggaccacatcaaa gacagctttcacagtttgcgggactcggtcccatcactccaaggagagaaggcatcccgg gcccaaatcctagacaaagccacagaatatatccagtatatgcgaaggaaaaaccacaca caccagcaagatattgacgacctcaagcggcagaatgctcttctggagcagcaagtccgt gcactggagaaggcgaggtcgagtgcccagctgcagaccaactacccctcctcagacaac agcctctacaccaacgccaagggcagcaccatctctgccttcgacggaggctcggactcc agctcagagtcggagcccgaagagccccaaagcaggaagaagctccggatggaggccagc taa

DBGET integrated database retrieval system