KEGG   Streptomyces genisteinicus: IAG43_27135
Entry
IAG43_27135       CDS       T07903                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
sgj  Streptomyces genisteinicus
Pathway
sgj00998  Biosynthesis of various antibiotics
sgj01100  Metabolic pathways
sgj01110  Biosynthesis of secondary metabolites
Module
sgj_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:sgj00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    IAG43_27135
Enzymes [BR:sgj01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     IAG43_27135
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase DUF3918
Other DBs
NCBI-ProteinID: QNP66245
UniProt: A0A7H0I0C9
LinkDB
Position
6304096..6304923
AA seq 275 aa
MHLQTRAAVVTGAASGIGLALSARFARAGAAVVMADVDGDALHRRAAELTAHGGRVTAVT
ADLTDPDAVEALADTAYDLLGDIDVVCNNAGVLGPVGQPLWEVPLERMRQVFEVNHWAHV
LVARAFVPRLLERGRPAHLIHTASMSAFAVGAGSAAYAASKHADLAVARSLRADLRGTGV
KVSVLCPGRVDTPMVRGLTAPRGAGGDTSVSAEEVASIVWEALGSDRFYLFSNSDAPLRL
RDQFDDVWRHVSLPPPSPEEELWPEPKATTVARKA
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgcacttgcagacaagggcggccgtggtgaccggcgcggccagcggcataggcctcgcc
ctcagcgcccgcttcgcgcgggccggcgccgccgtggtcatggcggacgtcgacggcgac
gcgctgcaccgccgcgcggccgaactcaccgcgcacggcggccgggtcaccgccgtgacc
gccgacctgaccgacccggacgccgtcgaagcactggcggacaccgcgtacgacctgctc
ggcgacatcgacgtggtgtgcaacaacgccggagtcctcggccccgtcggacagccgctg
tgggaggtgccgctggagcggatgcggcaggtcttcgaggtgaaccactgggcgcacgtc
ctggtggcccgcgccttcgtcccgcggctgctggagcgcggccggcccgcccatctgatc
cacaccgcctcgatgtccgccttcgccgtcggcgcgggcagtgccgcctacgccgcctcc
aagcacgccgacctcgcggtcgcccgcagtctgcgcgccgatctgcggggcaccggggtc
aaggtgtcggtgctgtgccccggccgggtcgacacccccatggtccggggcctgacggcc
ccgcgcggagcgggcggtgacacctcggtgagcgccgaggaggtcgcctccatcgtgtgg
gaggccctcggttccgaccgcttctatctcttcagcaactccgacgccccgctgcggctg
cgcgaccagttcgacgacgtgtggcgtcatgtctcccttccgcccccttcccccgaggag
gagctgtggcccgaaccgaaagcgacgaccgtggcgaggaaagcctga

DBGET integrated database retrieval system