KEGG   Streptomyces aurantiacus: GCM10017557_20590
Entry
GCM10017557_20590 CDS       T07085                                 
Symbol
asnB
Name
(GenBank) asparagine synthase B
  KO
K12674  (carboxyethyl)arginine beta-lactam-synthase [EC:6.3.3.4]
Organism
sgm  Streptomyces aurantiacus
Pathway
sgm00331  Clavulanic acid biosynthesis
sgm01100  Metabolic pathways
sgm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00331 Clavulanic acid biosynthesis
    GCM10017557_20590 (asnB)
Enzymes [BR:sgm01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.4  (carboxyethyl)arginine beta-lactam-synthase
     GCM10017557_20590 (asnB)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC NAD_synthase
Other DBs
NCBI-ProteinID: BCL27200
UniProt: A0A7G1NZY3
LinkDB
Position
2466726..2468267
AA seq 513 aa
MGPNLVAGFWARVSWSPRRAAPETPRFATQGHTSAVSAASAGRHLQGVAVSFGAPDTLVS
DGGIHLLLAGEIYNRDEVAKALGNASAAHGSDATLVLAAWHHWGITAFRILNGRFAALLL
DGGGRVVVATDHAGSVPLWLRADAHGVDVSTEAKTLAGLPGTPLDVAGAQLLPGGTGVHR
VQAGTALILETVQGEVRTANRVYTWTPPVSRAAVGEEIAVGRVRRLLAQAVQTRLRDDPE
PTVVLSGGIDSSGVAAHAVAHSGLVHSVSMGTEASDEFGPAKVVAGHLGTDHSEMTIHSS
DLVRELPWAVWAAEIADHTILEYLLPLIALYRRLPPGPRRVLTGYGADIPLGGMHRHTEP
LDLLDSVIAHDMATFDGLNEMSPVISGVAGIWSTHPYWDRDLLDCLISLDPGLKRRYGRD
KWVLREALARMLPAETLSRPKLGIHEGSGTSSAWTALLLEKGVPPGRVEQCKAAMARRMH
DLIVLRTRHPDEISFDEVLAATEKGRTRHALEQ
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgggacccaatcttgtcgcgggcttctgggcgcgcgtgtcgtggtcgccacgccgcgcc
gcgccggaaaccccccgcttcgcgactcagggccatacgagcgctgtctcggcggcgagc
gcgggccgccacctccaaggggtcgccgtcagtttcggcgcccccgacaccctggtctcc
gacggcggcatccacctgctgctcgccggcgagatctacaaccgcgacgaggtcgccaag
gcactcgggaacgcctccgccgcccacggcagcgacgccacgctcgttctggccgcctgg
caccactggggcatcaccgcgttccgtattctcaacggccgcttcgccgccctcctcctg
gacggcggcgggcgggtcgtcgtggccaccgaccacgccggctcggtcccgctctggctg
cgcgccgacgcccacggtgtcgacgtctccaccgaggccaagacgctcgccgggctgccc
ggcacccccctggacgtggccggcgcccagttgctgcccggcggtacgggggtgcaccgc
gtccaggcgggtaccgcgctgattctggagaccgtgcagggcgaggtgcggacagcgaac
cgggtgtacacctggacccccccggtgtcacgggccgccgtcggcgaggagatcgccgtc
ggccgggtgcgcaggctcctcgcacaggccgtccagacccggctgcgggacgatccggag
ccgaccgtggtgctctccggaggcatcgactccagtggcgtcgcggcgcacgcggtcgcg
cacagcggcctcgtccactccgtgtccatggggaccgaggcctccgacgagttcggaccc
gccaaggtggtggccggccacctgggcaccgaccactccgagatgacgatccacagctcc
gacctggtgcgggagctcccctgggccgtgtgggccgcggagatcgccgaccacaccatc
ctggagtacctgctgccgctgatcgcgctctaccgcagactgccgcccggcccacggcgt
gtcctgaccggctacggcgccgacatcccactgggaggcatgcaccggcacaccgaaccg
ctggacctcctggactccgtcatcgcccacgacatggccacgttcgacgggctgaacgag
atgtccccggtcatctcgggcgtcgccggcatctggtccacgcatccgtactgggaccgc
gacctgctcgactgcctgatctcgctcgaccccggtctcaagcgccgctacggccgcgac
aagtgggtgctccgcgaggccctggccaggatgctcccggccgagaccctgtcgcggccc
aagctcggtatccacgaggggtccggcacctccagcgcctggaccgccctcctcctggag
aagggcgtgccacccgggcgcgtcgaacagtgcaaggcggccatggcccggcgcatgcac
gatctgatcgtcctgcgcacccggcaccccgacgagatctccttcgacgaggtcctcgcg
gccactgagaaaggacggacccgccatgcactcgaacaatga

DBGET integrated database retrieval system