KEGG   Streptomyces aurantiacus: GCM10017557_51070
Entry
GCM10017557_51070 CDS       T07085                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sgm  Streptomyces aurantiacus
Pathway
sgm01057  Biosynthesis of type II polyketide products
sgm01100  Metabolic pathways
sgm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgm00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    GCM10017557_51070
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sgm01008]
    GCM10017557_51070
Polyketide biosynthesis proteins [BR:sgm01008]
 Polyketide tailoring proteins
  Others
   GCM10017557_51070
SSDB
Other DBs
NCBI-ProteinID: BCL30248
UniProt: A0A7G1P4G9
LinkDB
Position
5876937..5877914
AA seq 325 aa
MLSSATPALADEIVGGGTEAPKEEASGDAEGDTISATASGIVFDRSKNGSGGSVGAVRPT
TTWTPPACWYAPKYTPEQLQKQMEPIWEAGSTGSGWDSDQRNRYVNGEPYKDFNKDKTGK
GYFWDSFVDKSYPPGWDKCEEPPFWVDQGDPPPADIENAVTPEMLAQLAYAEIRVPGTEV
TLAPEGTTKVNLPTWAWLDGADFKPVSVTASVPLIGIEATTTAEPVSLKIEPGTADATTY
PASGVCELNGDEIGEAYAKGKAGETPPCGVKYLRSSGDGSYQLQATVTWKIHWTGTGVNE
DQPLPDGEFGAGQDVVVQEIQSVNR
NT seq 978 nt   +upstreamnt  +downstreamnt
atgctctcgagcgccactcctgcgctagccgatgaaatcgtcggcgggggcactgaggct
cccaaggaggaggcttctggagatgccgagggcgacaccatctccgcaaccgcgagcggc
atcgtcttcgaccgttccaagaacggcagcggcggttccgtcggagccgtaaggcccacg
accacctggaccccgcccgcctgctggtacgccccgaagtacaccccggagcagctccag
aagcagatggagccgatctgggaggccgggtcgaccggtagtgggtgggacagcgatcag
cgcaatcggtatgtcaacggggagccctacaaggacttcaacaaggacaagaccggtaag
ggctatttctgggactcgttcgtcgacaagagttatccgccgggctgggacaagtgcgag
gagccgcccttctgggtggatcagggagaccctccgccggccgacatcgagaacgccgtg
actcccgagatgctcgcccagctcgcgtacgccgagatccgggtgcccggcaccgaggtg
accctggcgcccgaaggcacgaccaaggtgaatttgccgacctgggcctggctggacggc
gccgacttcaagccggtctcggtcacggcgtccgtacccctgatcggcattgaggcgacg
accacggccgagccggtctcgttgaagatcgagccgggtacggcggatgcgacgacgtat
cccgcctccggggtgtgcgagctgaacggtgatgagatcggtgaggcgtacgcgaagggc
aaggccggcgagaccccgccgtgtggcgtgaagtatttgcgttcgtcgggcgacggctcg
tatcagctccaggcgacggtcacgtggaagattcactggacgggcaccggtgtgaacgag
gaccagcctttgccggacggcgagttcggggccggtcaggacgtggtcgtgcaggagatc
cagtccgtcaaccgctga

DBGET integrated database retrieval system