KEGG   Streptomyces aurantiacus: GCM10017557_78120
Entry
GCM10017557_78120 CDS       T07085                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
sgm  Streptomyces aurantiacus
Pathway
sgm00333  Prodigiosin biosynthesis
sgm01100  Metabolic pathways
sgm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GCM10017557_78120
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Abhydrolase_3 Hydrolase_4
Other DBs
NCBI-ProteinID: BCL32953
UniProt: A0A7G1PBE4
LinkDB
Position
complement(8893921..8894802)
AA seq 293 aa
MHTIERPARGPSPPRPPTAGWFHGFGPSTDTGTAPLRLVCVPYAGGTPSVYRNWAAHLGD
GVDVVPVLLPGRGLRLREAPYTAVGPLVAALADAFVEHDLAAHDYALFGHSMGALLAYEV
ACELRDRGLPEPTHLFVSGSKAPHLYGDRRDHTLSDADLRQLVRDLGGLGADDTIGSSYL
ERRLPVLRADLTACETYRWTPRRPLSCPMTAFSATRDPIAPPHEMEAWRVHTRGSLLRHH
MEGDHFFLNGPARPHLLREIRAELARRSDGSGDPGTAERDRLPTAKREPSWIY
NT seq 882 nt   +upstreamnt  +downstreamnt
gtgcacacgatcgagcggccggcgaggggtccttcgcctccgcggccaccaaccgccgga
tggttccacggcttcggcccgagcaccgacaccggcaccgcgcccctgcgtctcgtctgc
gttccgtacgcgggcggcacgccgtccgtctaccggaactgggcggcgcacctgggcgac
ggcgtggacgtcgtccccgtcctcctgcccggccggggactgcgcctgagggaggctccg
tacaccgctgtgggtccgctggtcgccgctctcgcggacgccttcgtcgagcacgacctc
gccgcccatgactacgccctgttcgggcacagcatgggcgcgctgctcgcctacgaggtc
gcctgtgagctgcgcgaccgcgggctgcccgagccgacgcacctcttcgtgtcgggcagc
aaggcgccgcacctgtacggcgatcgccgtgaccacaccctctccgacgcggatctgcgg
cagctggtgcgtgacctcggaggcctgggcgccgacgacaccatcggcagctcgtacctg
gaacggcggctgccggtgctgcgcgccgacctcaccgcctgcgagacctaccggtggacc
ccgcgccggcccctgagctgcccgatgaccgcgttctccgccacccgtgatccgatcgcg
cccccgcacgagatggaggcatggcgcgtccacacccgtggctcactcctgcgccaccac
atggagggtgaccacttcttcctcaacggccccgcgcggccgcacctcctgcgcgagatc
cgtgccgaactcgcccgccgttccgacggctcgggcgacccggggacggcggagcgagac
cgactgcccactgcgaagagggaaccctcatggatctactga

DBGET integrated database retrieval system