KEGG   Streptomyces aurantiacus: GCM10017557_78240
Entry
GCM10017557_78240 CDS       T07085                                 
Name
(GenBank) RedV protein
  KO
K21785  4-hydroxy-2,2'-bipyrrole-5-methanol dehydrogenase
Organism
sgm  Streptomyces aurantiacus
Pathway
sgm00333  Prodigiosin biosynthesis
sgm01100  Metabolic pathways
sgm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgm00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    GCM10017557_78240
SSDB
Motif
Pfam: Nitroreductase
Other DBs
NCBI-ProteinID: BCL32965
UniProt: A0A7G1PHC9
LinkDB
Position
8912369..8913640
AA seq 423 aa
MTSSPTSTHRTPSAERRSPFEAALREAADIAALSPSSHNCQPWGVAWPVSSGARQAAARR
VDEARGGGTSAESISDGSDGSDGCDGSSRSEYVVLALDRERELTSLPAHAVEMQLSCGAY
LQILLRSLALLGWSTDGIGFVEPRPGEQERGRSDFHRRLGDTWPASWSPLCAVRLRRTGP
PSGALAELRRTARARVTNRAPYRTEAVEPAVLAGLRAPSAGVAEGAEVTVRHLVADSERA
VFADVVARHGGRDFSHRQAWRETHSFLRRNEAEAAAQGDGFALSQLFGPMSGPRRLALRT
ALAPTTMRVLRYAGYHRVLARQLARVVRPTPVVVAMSFADSVPGLEATVRGGAHLAEYWM
RATDAGLALHPVSVVLQHDDVRTELQDRLGLPGRTFFVSRLGRSLTEFPPSRRRIASSAV
RPI
NT seq 1272 nt   +upstreamnt  +downstreamnt
atgaccagctcacccacctcgacgcatcggacgccttccgcggaacgccggtcgcccttc
gaggccgccctgcgtgaagcagccgacatcgcggcactcagcccgtcgtcgcacaactgc
cagccctggggcgtcgcctggcctgtcagcagtggtgcacggcaggcggcggcacggcgc
gtcgacgaggcccgcggcggcggcacttcggctgagagcatctctgacggctctgacggc
tctgacggctgcgacggctccagccggtccgagtacgtggtcctggccctcgaccgggag
cgtgagctcacctccctgcccgcgcacgccgtcgagatgcagctcagctgcggcgcgtac
ctccagatcctgctgcgttccctggctctcctgggatggtcgacggacggcatcggtttc
gtcgaaccgcgcccaggcgagcaggagcgtgggcgcagcgacttccatcgccggctcggc
gacacctggccggcgtcgtggtcacccctgtgcgccgtccgcctgcgccgcacgggccca
ccctccggcgctctcgccgaactccggcgtaccgcccgggcccgggtgaccaaccgcgcg
ccctaccgcaccgaagcagtcgaaccagccgtgctggccggcctccgcgcgccgtcggca
ggcgtcgccgagggcgcggaggtcaccgtccggcatctcgtcgccgacagcgagcgcgcg
gtcttcgccgacgtcgtggcccgccacggcggacgggacttcagccatcggcaggcgtgg
cgcgaaacgcactcgttcctgcggcggaacgaggccgaggccgcggcacagggcgacggc
ttcgccctcagccagctgttcgggccgatgtcggggccccgtcggctcgccctgcgcacc
gcgctggctccgaccacgatgcgagtgctccggtacgcgggttaccaccgcgtgctcgcc
cgccaactcgcccgcgtcgtacggccgacgcccgtcgtcgtcgccatgagtttcgccgac
tcggttcccggcctggaagccaccgtccgcggtggagcgcacctggccgaatactggatg
cgcgccacggacgcggggcttgcgctgcaccccgtcagcgtcgtcctgcagcacgacgac
gtacgaacggaactgcaggaccggctcggactgccgggccgtactttcttcgtgagccga
ttggggcgttctctcacggaatttccgccatcgcggcgccggattgcttcctctgccgta
cggccgatctga

DBGET integrated database retrieval system