KEGG   Streptomyces griseus: SGR_5933
Entry
SGR_5933          CDS       T00691                                 

Symbol
strB1
Name
(GenBank) scyllo-inosamine-4-phosphate amidinotransferase
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
sgr  Streptomyces griseus
Pathway
sgr00521  Streptomycin biosynthesis
sgr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGR_5933 (strB1)
Enzymes [BR:sgr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     SGR_5933 (strB1)
SSDB
Motif
Pfam: ADI
Other DBs
NCBI-ProteinID: BAG22762
Kitasato: SGR5933
UniProt: B1W380
LinkDB
Position
6942395..6943441
AA seq 348 aa
MSLVSVHNEWDPLEEVIVGTAVGARVPTADRSVFAVEYAGDYESQEQIPSGAYPDRVLKE
TEEELHVLAAELTKLGVTVRRPGPRDHSALIKTPDWETDGFHDYCPRDGLLSVGQTIIET
PMALRSRFLESLAYKDLLLEYFASGSRWLSAPKPRLTDDSYAPQAPAGERLTDEEPVFDA
ANVLRFGTDLLYLVSDSGNELGAKWLQSAVGDTYTVHPCRKLYASTHVDSTIVPLRPGLV
LTNPSRVNDENMPDFLRSWENITCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRR
QTALIRLLEKHGMNVLPLQLTHSRTLGGGFHCATLDVRRTGALETYQF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagccttgtaagcgtccacaacgaatgggacccgctggaggaggtcatcgtcggcacg
gcggtgggcgcccgggttcccaccgcggaccgaagcgtcttcgcggtggagtacgcgggg
gactacgagagccaggagcagatcccctcgggtgcctacccggaccgtgtgctcaaggag
accgaagaggaactccacgtactcgcggcggagttgaccaagctcggagtcaccgtccgg
cgccccggccctcgcgaccactcagccctgatcaagacccccgactgggagacggacggg
ttccacgactactgcccgcgcgacggcctgctgtcggtggggcagaccatcatcgagaca
ccgatggccctccggtcccgcttcctggagtcgctcgcctacaaggacctcctgctggag
tacttcgccagcggatcccgctggctgtccgcgcccaagccgcggctgaccgacgactcc
tacgccccgcaggccccggccggcgagcgcctcaccgacgaggagccggtgttcgacgcc
gccaacgtgctgcgcttcggcaccgacctgctctacctggtgtcggacagcggcaacgaa
ctgggcgccaagtggctccagtcggcggtcggcgacacctacaccgtccacccctgccgc
aagctgtacgcctccacccacgtcgactccaccatcgtgcccctgcggcccggcctcgtc
ctgaccaacccctcacgggtgaacgacgagaacatgcccgacttcctgcggtcctgggag
aacatcacctgccccgagctcgtggacatcggcttcaccggcgacaagccgcactgctcg
gtgtggatcgggatgaacctgctggtggtgcggcccgacctggccgtggtcgaccgccgg
cagaccgcgctgatccggcttctggagaagcacggcatgaacgtgctgcccctccagctg
acccactcgcgcaccctcgggggcggcttccactgcgcgaccctcgacgtgcggcgcacc
ggcgccctggagacgtaccagttctga

DBGET integrated database retrieval system