KEGG   Streptomyces glaucescens: SGLAU_01160
Entry
SGLAU_01160       CDS       T03327                                 

Symbol
strB1
Name
(GenBank) putative scyllo-inosamine-4-phosphate amidinotransferase
  KO
K04340  scyllo-inosamine-4-phosphate amidinotransferase 1 [EC:2.1.4.2]
Organism
sgu  Streptomyces glaucescens
Pathway
sgu00521  Streptomycin biosynthesis
sgu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sgu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SGLAU_01160 (strB1)
Enzymes [BR:sgu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.4  Amidinotransferases
    2.1.4.2  scyllo-inosamine-4-phosphate amidinotransferase
     SGLAU_01160 (strB1)
SSDB
Motif
Pfam: ADI
Other DBs
NCBI-ProteinID: AIR96260
UniProt: A0A089YRI1
LinkDB
Position
complement(286795..287841)
AA seq 348 aa
MSLVSVHNEWDPLEEIIVGTAVGARVPRADRSVFAVEYADEYDSQDQVPAGPYPDRVLKE
TEEELHVLSEELTKLGVTVRRPGQRDNSALVATPDWQTDGFHDYCPRDGLLAVGQTVIES
PMALRARFLESLAYKDILLEYFASGARWLSAPKPRLADEMYEPTAPAGQRLTDLEPVFDA
ANVLRFGTDLLYLVSDSGNELGAKWLQSALGSTYKVHPCRGLYASTHVDSTIVPLRPGLV
LVNPARVNDDNMPDFLRSWQTVVCPELVDIGFTGDKPHCSVWIGMNLLVVRPDLAVVDRR
QTGLIKVLEKHGVDVLPLQLTHSRTLGGGFHCATLDVRRTGSLETYRF
NT seq 1047 nt   +upstreamnt  +downstreamnt
atgagcctggtcagtgtgcacaacgaatgggacccgctggaggagatcatcgtcggaacg
gcggtcggtgcccgggtcccccgggccgaccgcagcgtgttcgccgtggagtacgcggac
gagtacgacagccaggaccaggttcccgccggcccgtacccggaccgggtgctcaaggag
accgaggaggaactgcacgtcctgagcgaggagctcaccaagctcggcgtcaccgtccgg
cggcccgggcagcgtgacaactcggccctggtcgccacccccgactggcagaccgacggc
ttccacgactactgcccgcgcgacggactgctcgcagtcggccagaccgtcatcgagtca
ccgatggcgctgcgcgcccgtttcctcgagtccctcgcctacaaggacatcctgctggag
tacttcgccagcggtgcccggtggctctccgcgcccaagccgcggctcgccgacgagatg
tacgagccgaccgcgcccgcgggacagcggctgaccgacctggagccggtgttcgacgcc
gccaacgtgctccggttcggcaccgacctgctctacctggtctccgacagcggcaacgaa
ctgggcgcgaaatggctccagtcggcgctcggcagcacctacaaggtccacccctgccgc
ggcctgtacgcctccacgcacgtcgactccacgatcgtgccgctgcgcccgggcctggtc
ctcgtcaacccggcgcgcgtcaacgacgacaacatgccggacttcctgcgctcctggcag
accgtcgtctgcccggagctggtggacatcggcttcaccggggacaagccgcactgctcg
gtgtggatcggcatgaacctgctggtggtccgccccgacctcgcggtcgtcgaccgccgt
cagaccggcctgatcaaggtgctggagaagcacggcgtcgacgtgctgccgctccagctc
acgcactcgcgcaccctcggcggcggcttccactgcgccacgctggacgtccggcggacc
ggctccctggagacctaccggttctga

DBGET integrated database retrieval system