KEGG   Sulfurospirillum halorespirans: SHALO_1495
Entry
SHALO_1495        CDS       T04475                                 

Definition
(GenBank) tetrachloroethene reductive dehalogenase catalytic subunit PceA
  KO
K21647  tetrachloroethene reductive dehalogenase [EC:1.21.99.5]
Organism
shal  Sulfurospirillum halorespirans
Pathway
shal00625  Chloroalkane and chloroalkene degradation
shal01100  Metabolic pathways
shal01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:shal00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SHALO_1495
Enzymes [BR:shal01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.99  With unknown physiological acceptors
    1.21.99.5  tetrachloroethene reductive dehalogenase
     SHALO_1495
SSDB
Motif
Pfam: Dehalogenase Fer4_16 Fer4_7 Fer4_6 Fer4 Fer4_9 UCR_Fe-S_N Fer4_10
Other DBs
NCBI-ProteinID: AOO65270
UniProt: A0A1D7TK12
LinkDB
Position
1506029..1507534
AA seq 501 aa
MEKKKKPELSRRDFGKLIIGAGAAATIAPFGVPGANAAEKEKNAAEIRQQFAMTAGSPII
VNDKLERYAQVRTAFTHPTSMFKPNYKGEVKHWFLSSCDEKVRQIENGENGPKMKAKNVG
EARAGRALEAAGWTLDNNFGGSFGSYYPNRFSMLWSGETMLNTQMWATVGLDRRPPDTTD
PVELTNYVKFAARMAGADLVGVARLNRNWVYSGAVTIPDEQSWHKEIEKPIVFKDVPLPI
ETDDELIIPNTCENVIVAGIAMNREMLQTAPTSMACATVAFCYSRMCVFDMWLCQFIRYM
GYYAIPCCNTVGQSVAFAVEAGLGQASRMGAFITPEFGPNVRLTKVFTNMPLVPDKPIDF
GVTEFCETCKKCARECPSKAITEGPRTFEGRSIHNQSGKLQWQNDHSKCLDYWPESGGNC
GTCFAVCPFTKGNIWIHDGVEWLIDNTRFLDPLMLGMDDALGYGAKRNITEIWDGKINTY
GLDADHFRDTVSFRKDRVKKS
NT seq 1506 nt   +upstreamnt  +downstreamnt
atggaaaagaaaaaaaagcctgaactctcaagaagagattttggtaagttgattatcgga
gctggagctgcagcaacgatagctccatttggtgtaccaggtgcaaatgcagctgaaaaa
gagaaaaatgcagctgaaattcgtcaacaatttgcaatgactgcaggttctcccatcata
gttaacgacaaattggaaagatatgctcaagtacgaacagcgtttactcatccaacctca
atgtttaaaccaaactacaaaggtgaagtgaaacattggtttttatcatcatgtgatgag
aaagtacgtcagattgaaaatggtgaaaatggtcctaagatgaaagctaaaaatgtagga
gaagctagagcaggtcgtgcacttgaagctgctggatggaccttagataataactttgga
ggttcttttggaagttattatccaaatagattttctatgttatggtctggtgagactatg
cttaacacccaaatgtgggcaacagtagggttagatagaagacctccagatacaactgat
cctgtggaacttacaaattatgtaaaatttgctgcacgtatggcaggtgctgatttggta
ggtgttgcaagattaaatcgtaactgggtttattctggggcagtaactataccagatgaa
caatcttggcataaagagattgaaaagccaatcgttttcaaagatgttccactaccaata
gaaactgatgatgaattaattatccctaatacttgtgaaaatgttatcgttgcaggtatc
gctatgaaccgcgaaatgttgcaaacagctcctaccagtatggcatgtgcaacagtagca
ttttgttattcacgtatgtgtgtgttcgatatgtggttatgccagtttattcgttatatg
ggttactatgcaattccatgctgtaatactgttggacaatcagttgcctttgctgttgaa
gcaggtttaggacaagctagtcgtatgggtgcttttattactcctgagtttggaccaaac
gtaagacttacaaaagtctttacaaatatgcctttagttccagataagcctatcgacttt
ggagtaacagaattttgtgaaacatgtaaaaaatgtgcacgtgagtgtccttcaaaagca
attactgaaggtccaagaacttttgaaggacgaagtattcataatcaatcaggtaaatta
cagtggcaaaatgaccatagtaaatgcttagattattggccggaatctggtggaaattgt
ggtacgtgttttgctgtatgcccgtttactaaaggtaatatctggattcatgatggcgtt
gaatggcttattgataacacaagattcttagacccattaatgcttggtatggatgatgca
ttgggctatggtgcaaaacgaaatattacagaaatttgggatggaaagattaatacatat
ggtctagacgcagaccattttagagacactgtaagctttagaaaggatagggttaaaaaa
tcatga

DBGET integrated database retrieval system