KEGG   Streptomyces harbinensis: HUT13_24830
Entry
HUT13_24830       CDS       T07389                                 
Name
(GenBank) amino acid adenylation domain-containing protein
Organism
shar  Streptomyces harbinensis
SSDB
Motif
Pfam: AMP-binding Condensation PP-binding KR Thioesterase AMP-binding_C adh_short_C2 adh_short Abhydrolase_3
Other DBs
NCBI-ProteinID: QKV71635
UniProt: A0A7H8H6N7
LinkDB
Position
5489906..5497912
AA seq 2668 aa
MSTRHTKRASELIRHRGRRYPVATVEAGALRADDIAECAVVQCRTAGGATRAVAFVRTTS
GRAVTAEDLPGVPVDEVVTLSSLPLDRHGRVDYALLRQAAVLDRETLSEAESAWRTSHGL
RESAVLHREVYDYGSPVAPLAPPAPAADEDTAPAAGPRPAVPAYIQGPPILEVPGDAQTV
TATLYRAARAGEDTGCHFVDAAGRTVSVPYARLLARAERVAAHLQRDGVTTGDRVLLLAG
SQEEFTVALWGTLLCGATAVPVTPSADYRERRTEAEALRRIWTTARRPRVLTTPGLLPEA
ARLLDGATLLSLAEAEAHDGTPRPVDIAPDLPALILFTSGSTGTPKGVVQSHATLLNKQR
AAVQHSGYAADDVFLNWLAIEHVVGLVHAHLLPVYLGARQVHAATDYVLHEPLRWAELAS
THRATNTWGPNSMLALLADAVADAAPARWDLSAVRRWINAGEQVHYATCQRLLTLLEPYG
LPADAVKPEWGMSETCNMVIVSDELARGRTTGVRDVRRIHPDGTLDFADRPGGSGGRFVE
CGRVYPGVEARVVDEEGTVVPEGRIGTFQVRGATRLLEYFNNPGANARFFREDGWFDTGD
LAFIQDRRVTFTGRGADRIIVNGLNYQNVDLEALVETVPGVLPTFAAACSVRAEDDVTDH
LAVFYVPETTDPAGAPRHIREIQAALRREFGMSARYVVPLRTEQIPKTSIGKIQRGKLVA
RLTAGEYDEILRSTGQLRGTRRTQVPPWFFTETTHPRVLPPAAAGRPVALTLDGGAPADR
EQVGRALAGVLTVVTGPVEEHSERPLDARVDLTLTRDGWGADDVLALLESTTGRLTADGG
EAAGPRRILLVSVAARGRDDTARAYLGALQGYVRSVNDDTGAPTVVWCDLDTLDAATATA
LAAELTSSAGSPVVAHHGGVRTERVLAPAPVAPAPAPVAPAPAPVAGGGTALRTGGSYLI
SGGLGGVGREVSRFLADRYGARLILVGSTPEERLDEDRRRALAALAARTRVRYVTVDLAA
PDAPARLRAAVGPDAGRLDGAFHLAGLGTFGQESLDGLGERGTVDGEQLARYTALKVGGL
FALAEAAGPAAPLVAFSSVNAYFGGAGYAEYSASNSALNEAVRVLRARGHGAAVSLGWSA
WAGLGMSRGSALPIERRGFVPLEPDPALESLLLALGHDRPVTYVGLDGAHPGIAAQVRHK
PGWRLVPAYYYAAGTELPADGIAALAPGTEIAQVPQLPRRRDGRLDTVRLLQSAGTRATG
ARPETETERRLAAVWERILGTEDLARDDDFFSLGGHSLMAARLGNDIRAEFGVTLALHEV
FGDPTLAAIAAVIDAKSAHPADTPDTSAAPGAEPEDGLSAAQRRIFFAESVEPGLALYNI
VAAWELTGALDAELLEKALHHVVRRHEALRTVFDTVEGSPVARVVDRPEVPLRRVALDTL
DEEEAQARLARTLDAELRHVYDLAAAPLARCTLAALPGDRAVLIVSHHHLASDGWSLGVF
MRDLVLVYNALADRDLPELPALPADVPALVRRQDAAGAASEQAAEHWRRQLSRDIAPLEL
PLDHPRPQMQSYAGDTLFLELGPEEVCRISTAAAGAGVSTAVWLATAYGVLLARLTGRQE
FLVGMPAMRRDDPALADAVGMLVNTLPHLMTVPADRPVDAQCAAVRQGMTDLLRYQDYPF
DHMVARFGPERDTSRPPLVQTMFNYVPMEGFPQFTGTTRAPLELRHPIARFDFSLHAYER
ENGLVLAFEYATALFRAETVRGWQQAFRTLIEAMAAGPRTPVGELAVVPAGERERALTLG
RNTRAVPEQGSVAAAFAATARAHPDRTALEHGADTLTYRELDDRSAALAAHLAGHGVAAG
DRVALDAAKRIDTITGMLAVLRLGASYVPVDPEQPAPVTAAVLRAGGIRGHLTTGGWTGI
DADGERTGAVREIPSGPAAAAPPHREISGADEAYVMFTSGTTGRPKGVAIANSSVVGLVR
DPDWISFGTGTRVLQTGSLSFDAATLEVWAPLLNGGTLVLTDKENILDVTRLRAEIERSQ
PTLMWVSAPLFHQLTDADPALFTGVADLLVGGDVVSPEHVNRVLERSPGTRITNGYGPTE
NTTFTTTHTMTAPVDGPVPIGRPIRGRTALVADESGQVVPFGVQGELYVGGEGLALGYVG
NTEETARRFTELPALPGERLYRTGDFATQDADGVIHYRGRKDGQVKVRGHRVELDAVRAA
LCSLPGVRDAFVLSLPDAGGALAAHVAADGTDAAELRTRVRTLLPPYAVPSAIQVYDALP
LKSSGKVDVALLRTGTATAPAEPAAATGTAEPLPPHAERLLAAYAAVLNVPHVGPDDSFF
DLGGDSLLTIKLVSVLREEGVPVDPKQVFLYPDVRTLAAALEDHEQQLTARGGRPAAKLV
RLRPEPGDGPDLVLAPPAGGTVLGYIELARHLRGFGRIHGVEAPGLGAGESLVLPSFEEA
VDFCYEAAQDVLGNSGYVGGHSLGGHIAFHLASALIDKGVKPKGLIILDTPPNLGDIPVA
DADLTEEETRVFILAMGIGGMLDQDRDRLRQLPYEEAKRVLLERARKDPRVSAFLSAEYL
DRFLRLQMHQLMYSREVALPDRALDIPVFVFRTGEHGTDVARLFSDWSRYTTREVTFVDI
PGDHASMLRAPHVTEVARLLDQHCGAPR
NT seq 8007 nt   +upstreamnt  +downstreamnt
atgagtacgcgtcacaccaagagagcatccgaactgatccgccaccgggggcgccgctac
ccggtcgccaccgtggaggccggcgcgctgcgagcggacgacatcgccgagtgcgccgtc
gtgcagtgccgcaccgccggcggagccacccgcgccgtcgccttcgtccgcaccacctcc
ggccgcgccgtcaccgccgaggacctgcccggcgtaccggtggacgaggtcgtcaccctc
agcagcctgccgctggaccggcacggccgggtcgactacgcgctgctgcgccaggccgcc
gtcctggaccgcgagacgctgagcgaagccgagagcgcctggcggacgtcgcacgggctg
cgcgagagcgccgtcctgcaccgcgaggtctacgactacggctccccggtggcgccgctc
gccccgcccgccccggcggccgacgaggacaccgccccggccgccggcccgcggcccgcc
gtccccgcctacatccaggggccgccgatcctggaggtgcccggggacgcgcagaccgtc
accgccacgctgtaccgcgccgcccgcgcaggcgaggacaccggctgccacttcgtggac
gccgccggccgcaccgtgtccgtcccctacgcccggctgctggcccgggccgaacgggtc
gccgcccacctccagcgggacggggtgaccaccggcgaccgcgtgctgctgctggccggc
agccaggaggagttcaccgtcgccctgtggggaacgctgctgtgcggcgccaccgccgta
cccgtcaccccctccgccgactaccgggagcggcgcaccgaggccgaggccctgcggcgg
atctggaccacggcccgccggccccgcgtgctgaccaccccgggcctgctgccggaggcg
gcccgcctgctggacggcgcgacgctgctgtccctggccgaggccgaggcgcacgacggc
accccgcgcccggtcgacatcgcccccgacctgcccgcgctgatcctgttcacctcgggc
agcaccggcacccccaagggcgtcgtgcagtcgcacgccaccctgctgaacaagcagcgg
gcggcggtccagcacagcggctacgcggccgacgacgtcttcctcaactggctcgcgatc
gaacacgtcgtgggcctggtccacgcccatctgctgcccgtctacctgggcgcccggcag
gtgcacgccgcgaccgactacgtgctgcacgaacccctgcgctgggccgaactggcgagc
acccaccgcgcgaccaacacctggggccccaactccatgctggcgctgctcgccgacgcg
gtggcggacgccgcccccgcccgctgggacctgtccgccgtacgccgctggatcaacgcc
ggcgagcaggtgcactacgccacctgccagcggctgctgaccctgctggagccgtacggg
ctcccggcggacgccgtcaaacccgagtggggcatgtcggagacctgcaacatggtcatc
gtctccgacgaactggcacgcgggcgcaccaccggcgtacgggacgtacgccgcatccac
ccggacggcaccctggacttcgccgaccgccccggcggctccggcggccggttcgtcgag
tgcggccgggtctaccccggagtggaggcccgggtcgtcgacgaggagggcaccgtggtg
ccggagggccgcatcggcaccttccaggtgcgcggcgccacccggctgctggagtacttc
aacaaccccggggccaacgcccggttcttccgcgaggacggctggttcgacaccggggac
ctggcgttcatccaggaccgcagggtcaccttcaccggccgcggcgccgaccgcatcatc
gtcaacggcctcaactaccagaacgtggacctggaggcgctggtcgagaccgtccccggc
gtcctccccaccttcgccgcggcctgctcggtacgcgccgaggacgatgtgaccgaccat
ctggccgtcttctacgtccccgagaccaccgacccggccggcgcgccccgccacatccgg
gagatccaggccgcgctgcgccgcgagttcggcatgtccgcccgctacgtggtgccgctg
cgcaccgagcagatccccaagacgagcatcggcaagatccagcgcggcaagctcgtcgcc
cggctcaccgccggcgagtacgacgagatcctgcgctccaccggacaactgcgcggcacc
cggcggacccaggtcccgccgtggttcttcaccgagaccacgcacccgcgcgtcctgccc
cccgccgcggccggccggccggtcgcgctcaccctggacggcggcgcccccgccgaccgc
gaacaggtcggccgcgccctggccggcgtgctgaccgtggtgaccgggccggtcgaggag
cactccgagcggccactggacgcccgggtcgatctgaccctcacccgggacggctggggc
gcggacgacgtgctcgcgctcctggagtccaccaccggccggctcaccgccgacggcggg
gaagcggccggtccccgccggatcctgctggtcagcgtcgccgcccggggccgcgacgac
accgcccgcgcctacctcggcgcgctccagggctatgtgcgcagtgtcaacgacgacacc
ggggcacccaccgtcgtgtggtgcgacctcgacaccctcgacgcggcgaccgcgacggcc
ctggccgccgaactgacctcctccgcgggcagcccggtggtcgcccaccacggcggcgtc
cgcactgaacgggtgctggccccggcccccgtcgcccccgccccggcccccgtcgccccc
gccccggcccccgtcgccggtggtggcacggccctgcgcaccggcggcagctatctgatc
agcggcggcctcggcggcgtcggccgcgaggtgagccgtttcctggccgaccggtacgga
gcgcggctgatcctcgtcggcagcacccccgaggagcgactggacgaggaccgccgccgc
gcactggccgcactggcggccaggacccgggtccggtacgtcaccgtggacctcgccgcc
cccgacgcgccggcccggctgcgggcagcagtcggccccgacgccggacgcctcgacggg
gcgttccacctcgccggcctcggcaccttcggccaggagtccctggacggcctcggcgag
cgcggcaccgtggacggcgagcaactggcccggtacaccgccctcaaggtgggcggcctg
ttcgccctcgcggaagccgccggcccggccgcgcccctggtcgccttcagctccgtcaac
gcctacttcggcggcgccggatacgccgagtactccgcgtccaacagcgcgctcaacgaa
gcggtgcgcgtgctgcgcgcccgcggccacggcgcggccgtctccctcggctggagcgcg
tgggcgggcctgggcatgtcgcgcggctccgccctgccgatcgagcggcgcggcttcgta
cccctggagccggacccggccctggagtcgctgctgctcgccctcggccacgaccggccc
gtcacctacgtcggcctggacggcgcccaccccggcatcgccgcccaggtgcgccacaag
cccggctggcggctcgtcccggcgtactactacgccgccggtaccgaactgcccgccgac
ggcatcgccgcgctcgcgcccggcacggaaatcgcccaggtaccgcagctcccgcggcgg
cgcgacggccggctggacaccgtccggctgctccagtcggcaggcacccgcgccaccggc
gcccgccccgagaccgagaccgaacgccggctggcggcggtgtgggaacgcatcctcggc
accgaggacctcgccagggacgacgacttcttctccctcggcgggcactccctgatggcg
gcacggctcggcaacgacatccgcgccgagttcggcgtcaccctcgccctgcacgaggtg
ttcggcgacccgaccctggcggccatcgccgcggtcatcgacgcgaaatcggcgcacccc
gccgacacccccgacacctccgccgcccccggggccgagcccgaggacggcctgtcggcc
gcccagcgccggatcttcttcgccgagagcgtcgaacccggcctggccctgtacaacatc
gtggccgcctgggagctgaccggcgccctcgacgcggaactgctggagaaggccctgcac
cacgtggtgcggcggcacgaggccctgcggacggtcttcgacaccgtggagggatcgccc
gtcgcccgcgtcgtggaccggcccgaggtgccgctgcgccgggtcgcgctggacaccctc
gacgaggaggaggcccaggcccggctggcgcggaccctcgacgcggaactgcgccacgtc
tacgacctggccgccgcacccctggcccgctgcaccctcgccgcgctgcccggcgaccgg
gcggtcctgatcgtctcgcaccaccacctggcctccgacggctggtcgctcggggtgttc
atgcgcgatctggtcctggtgtacaacgcgctggccgaccgggacctgccggagctgccc
gcgctcccggcggacgtcccggcactcgtccgccgccaggacgcggccggcgccgcctcc
gagcaggccgccgagcactggcgccggcagctgtcgcgcgacatcgccccgctggaactg
cccctggaccacccacggccgcagatgcagtcctacgccggggacaccctcttcctggag
ctgggccccgaggaggtatgccggatcagcacggcggcggccggggccggcgtctccacg
gccgtctggctggccaccgcctacggggtgctgctcgcccggctcaccggacggcaggag
ttcctcgtcggcatgcccgcgatgcggcgcgacgacccggccctggccgacgcggtcggc
atgctcgtcaacaccctgccgcacctgatgacggtcccggcggaccggccggtggacgcc
cagtgcgccgccgtccggcagggcatgacggacctgctgcggtaccaggactacccgttc
gaccacatggtggcccgcttcgggcccgaacgggacacctcccgcccgccgctggtgcag
accatgttcaactacgtcccgatggagggcttcccgcagttcaccggcaccacccgcgcc
ccgctggaactgcgccaccccatcgcccgcttcgacttctcgctgcacgcctacgagcgg
gagaacggcctcgtcctcgccttcgagtacgccaccgccctgttccgggccgagacggta
cgcggctggcagcaggcgttccgcaccctgatcgaggccatggccgccggcccgcgcaca
ccggtgggcgagctggccgtggtacccgccggggaacgcgaacgggccctgaccctgggc
cgcaacacccgcgcggtgcccgaacagggctcggtggccgcggcgttcgccgccaccgcc
cgcgcccacccggaccgcaccgccctggaacacggcgcggacaccctcacctaccgggag
ctggacgaccgcagcgccgcactcgccgcacacctcgccggacacggcgtggcggccggc
gaccgggtcgccctggacgcggccaagcgcatcgacacgatcaccggcatgctcgccgtc
ctgcggctcggcgcctcctacgtacccgtcgaccccgagcagccggcgccggtgaccgcc
gccgtcctgcgggccggcggcatccgcggccacctcaccaccggcggctggaccggcatc
gacgcggacggcgaacgcaccggagcggtacgggagataccctccggcccggccgccgcc
gccccgccgcaccgggagatctccggcgccgacgaggcgtacgtcatgttcacctccggc
accaccggccggcccaagggcgtcgccatcgccaactccagcgtggtgggcctggtcagg
gacccggactggatctccttcggcaccggcacccgggtgctccagaccggatcgctgtcc
ttcgacgccgccaccctggaggtgtgggcgccgctgctcaacggcggcaccctcgtcctc
accgacaaggagaacatcctcgacgtcacccggctgcgcgccgagatcgaacgctcgcag
cccaccctgatgtgggtgagcgccccgctgttccaccagctcaccgacgcggaccccgcg
ctgttcaccggggtcgcagacctgctggtgggcggcgacgtcgtctcgcccgagcacgtc
aaccgggtgctggagcgctccccgggaacccggatcaccaacggctacggccccaccgag
aacaccaccttcaccaccacccacaccatgaccgccccggtcgacggaccggtccccatc
ggccggccgatccggggccgtaccgccctcgtcgccgacgagagcggccaggtggtgccc
ttcggcgtccagggcgaactgtacgtcggcggcgaaggactggccctcggctacgtcggc
aacaccgaggagaccgcccgccgcttcaccgagcttcccgccctccccggcgaacgcctc
taccgcaccggcgacttcgccacccaggacgccgacggcgtgatccactaccggggccgc
aaggacggccaggtcaaggtgcggggccaccgggtggaactcgacgcggtacgcgccgcg
ctgtgctcgctccccggcgtccgcgacgccttcgtcctcagcctccccgacgccggcggc
gcactcgccgcgcacgtggcggcggacgggacggacgccgccgaactgcgcacccgcgtg
cgtaccctgctcccgccctacgcggtgccctcggcgatccaggtgtacgacgcgctgccg
ctcaagagcagcggcaaggtggacgtcgccctgctgcgcaccggcaccgccaccgccccg
gcggagccggccgccgcgaccggcaccgccgagcccctgccaccgcacgccgagcggctg
ctggccgcgtacgccgccgtactgaacgtgccgcacgtcggcccggacgactccttcttc
gacctgggcggcgactcgctgctcaccatcaagctggtgtcggtgctccgcgaggaaggc
gtgcccgtcgaccccaagcaggtcttcctctacccggacgtacgcaccctcgccgcggcg
ctggaggaccacgagcagcagctgaccgcccggggcggccggcccgccgccaagctggta
cggctgcggccggagcccggcgacggacccgacctggtgctcgccccgccggccggcggc
accgtgctcggctacatcgaactcgcccgccacctgcggggattcggccggatccacggc
gtcgaggcaccggggctcggcgccggggagagcctggtcctgccgagcttcgaggaagcg
gtcgacttctgctacgaggcggcgcaggacgtcctcggcaacagcggctacgtcggcggg
cactcgctcggcggccacatcgccttccacctggcctcggcgctcatcgacaagggcgtc
aagcccaagggcctgatcatcctcgacaccccgccgaacctcggcgacatcccggtggcc
gacgccgacctcaccgaggaggagacccgggtcttcatcctcgccatgggcatcggcggc
atgctggaccaggaccgcgaccggctgcggcaactcccgtacgaggaggccaagcgcgtc
ctgctggaacgggcccgcaaggacccgcgggtctccgcgttcctcagcgccgaatacctc
gaccggttcctgcggctccagatgcaccagctgatgtactcgcgcgaggtggcgctgccc
gaccgcgcgctggacatcccggtcttcgtcttccgcaccggggagcacgggaccgacgtc
gcgcggctcttctccgactggtcgcgctacaccacccgcgaggtcaccttcgtcgacatc
cccggcgaccacgcctcgatgctgcgcgcaccgcacgtcaccgaggtcgcccggctgctc
gaccagcactgcggcgccccgcgctga

DBGET integrated database retrieval system