KEGG   Streptomyces huasconensis: J2N69_25775
Entry
J2N69_25775       CDS       T07920                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
shk  Streptomyces huasconensis
Pathway
shk01100  Metabolic pathways
shk01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shk00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    J2N69_25775
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:shk01008]
    J2N69_25775
Polyketide biosynthesis proteins [BR:shk01008]
 Polyketide tailoring proteins
  Others
   J2N69_25775
SSDB
Other DBs
NCBI-ProteinID: UFQ20350
LinkDB
Position
complement(5630041..5630994)
AA seq 317 aa
MADIDPGGGDTETQVDADADEKTLSATAGGIVYDRSKNGKGSNAGPLIPATSWTPPPCYY
APAYTPAQLQKKLEPIWAVDSTGPEWDLTQRDRYVNGKPYKDFNKKKAGDGYWWDSFIPE
GRESAPGAFDCDEPYFWVDKGEPPPADAPEAVTPEILAHLAYAEIRVPDTEVSLAPAGTT
KVNLPTWAWLDKADFKPVSVTASVPVLQIEATATAEPVSLKIDPGTPDAEIYPASGVCDL
VGDRIGTPYAKGKAKETPPCGVKYLRSSGDGSYPLKATVTWKIRWTGTGVDGEQTLPDGE
FGAEQDVVVQEIQSINR
NT seq 954 nt   +upstreamnt  +downstreamnt
atggccgacatcgacccgggcggcggtgacaccgagacgcaggtggacgcggacgccgat
gagaagaccctgtcggccaccgcgggtgggatcgtctatgaccgttcgaagaacggcaaa
gggagcaacgctggtcccctgattcccgcgaccagttggacccctcctccctgctattac
gcccccgcctacacacctgcccagttgcagaagaagcttgagccgatctgggcggtcgac
tccaccggccccgaatgggacctgacccagcgcgaccgctatgtgaacggaaagccctac
aaggacttcaacaagaagaaggccggtgacggctactggtgggacagcttcatccccgag
ggcagggaaagtgcccctggcgcattcgactgcgacgagccctacttctgggtggacaag
ggtgagccgcctccggctgacgctcccgaggccgtcacgccagagatcctcgcgcatctc
gcctacgctgaaatccgcgtccccgacacggaggtgtccctcgcccccgcagggacgacg
aaggtcaatctgcccacctgggcctggctggacaaggcggatttcaagccggtctcagta
acggcctcggtgccggtcctgcagatcgaggcaacagcaacagccgaacccgtctccctc
aagatcgaccccggcacccccgacgccgagatctaccccgcgtccggcgtctgcgacctc
gtgggcgacaggatcggcaccccgtacgcgaagggcaaggccaaggagaccccgccctgc
ggtgtgaagtacctgcggtcctcgggcgacggttcgtacccgctgaaggcgacggtcacc
tggaagatccgctggacggggacgggcgtcgacggcgaacagactctcccggacggcgag
ttcggcgcggagcaggatgtggtggtccaggagatccagtccatcaaccggtag

DBGET integrated database retrieval system