KEGG   Streptomyces huasconensis: J2N69_35825
Entry
J2N69_35825       CDS       T07920                                 
Name
(GenBank) SDR family NAD(P)-dependent oxidoreductase
  KO
K17747  1-deoxy-11beta-hydroxypentalenate dehydrogenase [EC:1.1.1.340]
Organism
shk  Streptomyces huasconensis
Pathway
shk00998  Biosynthesis of various antibiotics
shk01100  Metabolic pathways
shk01110  Biosynthesis of secondary metabolites
Module
shk_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:shk00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    J2N69_35825
Enzymes [BR:shk01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.340  1-deoxy-11beta-hydroxypentalenate dehydrogenase
     J2N69_35825
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase Methyltransf_25 Ldh_1_N 3HCDH_N DUF3918
Other DBs
NCBI-ProteinID: UFQ19902
LinkDB
Position
complement(8060781..8061608)
AA seq 275 aa
MQLRTETAVVTGAASGIGFALSARFAQAGVAVVMADVAGDALRARAAELTARGARVTAVR
ADLTDPDAVAHLADTAFDVLGDIDVVCNNAGVIGPVGQPLWEVPLDRMREVFEANHWAHV
LVSRAFIPPLLERGRPAHLIHTASMSAFAVGAGSAAYAASKHADLAVARSLRADLRDTAI
RVSVLCPGRVETPMVQGLTAPRGAGGDTSVSAEDVASLVWEALGSDRFYLFSNSDAPLRL
RDQFDDVWRHVSLPPPSPEEELWHTPRATTEAMKH
NT seq 828 nt   +upstreamnt  +downstreamnt
gtgcagttacggacagaaacggccgtggtgaccggcgccgccagcggcatcggattcgcc
ctcagcgcccgcttcgcacaggccggcgtcgccgtggtcatggcggacgtagcgggcgac
gcgctgcgtgcgcgggcggccgaactcacggcgcgcggcgccagggtcaccgccgtgaga
gccgacctgaccgacccggacgccgtcgcacacctcgcggacaccgcgttcgacgtgctc
ggcgacatcgatgtggtgtgcaacaacgccggggtcatcggccccgtgggacagccgctg
tgggaggtgccgctggaccggatgcgggaggtcttcgaggcgaaccactgggcgcacgtc
ctggtgtcccgcgctttcatccccccgctcctcgagcgcggcaggcccgcccacctgatc
cacaccgcttcgatgtccgccttcgccgtcggcgcgggcagcgccgcctacgccgcctcc
aagcacgccgacctcgcggtcgcccgcagcctgcgcgccgatctgcgggacaccgcgatc
cgggtgtcggtgctgtgcccgggacgggtcgagacccccatggtccagggcctgaccgcg
ccgcgcggcgcgggcggcgacacctccgtgagcgccgaggacgtcgcctcactcgtgtgg
gaggccctcggctccgaccgcttctacctgttcagcaactccgacgccccattgcggctg
cgcgatcagttcgacgacgtatggcgtcatgtctcccttccgcccccttcccccgaggag
gagctgtggcacacgccgagagcgacgaccgaagcgatgaaacactga

DBGET integrated database retrieval system