KEGG   Sturnira hondurensis: 118983239
Entry
118983239         CDS       T07222                                 
Name
(RefSeq) LOW QUALITY PROTEIN: melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
shon  Sturnira hondurensis
Pathway
shon04927  Cortisol synthesis and secretion
shon04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:shon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    118983239
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    118983239
SSDB
Motif
Pfam: MRAP DUF485 FixQ
Other DBs
NCBI-GeneID: 118983239
NCBI-ProteinID: XP_036896445
LinkDB
Position
Unknown
AA seq 199 aa
MVNGTNTSALGYSYEYYLDYLDPIPVDERKLRAHKHAIAIAFWVGLMAFVLLLLLTLLYV
SWSGSPLARNHAQHQPTCPWGLRLDLPLRVLRHLLLHRPPRGTPQAPPSSTKEPQQLMQE
GPAPSTPTATQAHPGLLWEWALSGDPMASADVGHKPSWPPLEMGQTPANHGHCRVARDMN
QPRHMYHPKATAGHGKGGE
NT seq 600 nt   +upstreamnt  +downstreamnt
atggtcaacggcaccaacacctcggccctgggctacagctatgagtactacctggactac
ctggaccccatccccgtggacgagaggaagctgagagcccacaaacatgccatcgccatc
gccttctgggtgggcctgatggccttcgtgctgctgctgctcctcaccctgctctacgtg
tcctggtcgggctccccactggcgcggaaccacgcccagcaccagcctacctgcccctgg
ggtctccgcctggacctccccctccgcgtcctgaggcacctgctgctccacaggcccccc
cgggggaccccgcaggccccgcccagctccaccaaggagccacagcagttgatgcaggag
ggccccgccccctcgacccccactgccacccaggcccaccctggcctcctgtgggaatgg
gccctcagtggggaccccatggcatcagctgacgtcggccacaagcccagctggccaccc
ctggagatgggacagacgccagcaaaccacggccactgccgagtggcccgtgacatgaac
caacccaggcacatgtaccacccaaaagccaccgcaggtcacgggaagggcggtgagtga

DBGET integrated database retrieval system