Sturnira hondurensis: 118992994 Help Entry 118992994         CDS       T07222                                  Symbol FGF20 Name (RefSeq) fibroblast growth factor 20   KO K04358   fibroblast growth factor Organism shon  Sturnira hondurensis Pathway shon04010   MAPK signaling pathway shon04014   Ras signaling pathway shon04015   Rap1 signaling pathway shon04020   Calcium signaling pathway shon04151   PI3K-Akt signaling pathway shon04810   Regulation of actin cytoskeleton shon05200   Pathways in cancer shon05207   Chemical carcinogenesis - receptor activation shon05218   Melanoma shon05224   Breast cancer shon05226   Gastric cancer Brite KEGG Orthology (KO) [BR:shon00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118992994 (FGF20)    04014 Ras signaling pathway     118992994 (FGF20)    04015 Rap1 signaling pathway     118992994 (FGF20)    04020 Calcium signaling pathway     118992994 (FGF20)    04151 PI3K-Akt signaling pathway     118992994 (FGF20)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118992994 (FGF20)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     118992994 (FGF20)    05207 Chemical carcinogenesis - receptor activation     118992994 (FGF20)   09162 Cancer: specific types    05226 Gastric cancer     118992994 (FGF20)    05218 Melanoma     118992994 (FGF20)    05224 Breast cancer     118992994 (FGF20)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shon04052]     118992994 (FGF20)    00536 Glycosaminoglycan binding proteins [BR:shon00536]     118992994 (FGF20) Cytokines and neuropeptides [BR:shon04052]  Cytokines   Growth factors (RTK binding)    118992994 (FGF20) Glycosaminoglycan binding proteins [BR:shon00536]  Heparan sulfate / Heparin   Growth factors/receptors    118992994 (FGF20) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  118992994 NCBI-ProteinID:  XP_036910963 LinkDB All DBs Position Unknown AA seq 211 aa AA seqDB search MAPLTEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRGAAERGVRGGPGAAELAHL HGILRRRQLYCRTGFHLQILPDGTVQGTRQDHSLFGILEFISVAVGLVSIRGVDSGLYLG MNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRGGAR SKRHQKFTHFLPRPVDPERVPALYKDILIYT NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggctcccttaaccgaagtcgggggcttcctgggcggcctggagggcttgggccagcag gtgggctcgcacttcctgctgcctcccgccggggagcggccacctctgctgggcgagcgc cggggcgcggcggagcggggcgtccgcggcgggcccggggccgcggagctggcgcacctg cacggcatcctgcgtcgccggcagctctactgccgcaccggcttccacctgcagatcctg cccgacggcaccgtgcagggcacccggcaggaccacagcctcttcggtatcctggaattc atcagtgtggcagtgggactggtcagtattcgcggtgtggacagtggcctctacctggga atgaatgacaaaggagaactgtatggatcagagaaactgacttctgaatgcatctttagg gagcaatttgaagagaactggtataatacctattcatccaacatatataagcatggagac accggccgcagatattttgtagcacttaacaaagacggaactccaaggggtggtgcccgg tctaaaagacatcagaaatttacgcatttcctgcccagaccggtggatccagaaagagtg cccgccttgtacaaggacatcctgatatacacttga

DBGET integrated database retrieval system