Shigella sp. PAMC 28760: A0259_09020 Help Entry A0259_09020       CDS       T04390                                  Name (GenBank) hypothetical protein   KO K22501   cytochrome bd-II ubiquinol oxidase subunit AppX [EC:7.1.1.7] Organism shq  Shigella sp. PAMC 28760 Pathway shq00190   Oxidative phosphorylation shq01100   Metabolic pathways shq02020   Two-component system Module shq_M00153   Cytochrome bd ubiquinol oxidase Brite KEGG Orthology (KO) [BR:shq00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     A0259_09020  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     A0259_09020 Enzymes [BR:shq01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.7  quinol oxidase (electrogenic, proton-motive force generating)      A0259_09020 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  YbgT_YccB Adeno_E3B Motif Other DBs NCBI-ProteinID:  AMR22759 LinkDB All DBs Position 1825661..1825753 Genome browser AA seq 30 aa AA seqDB search MWYLLWFVGILLMCSLSTLVLVWLDPRLKS NT seq 93 nt NT seq  +upstreamnt  +downstreamnt atgtggtatttactttggttcgtcggcattttgttgatgtgttcgctctccacccttgtg ttggtatggctggacccgcgtctgaaaagttaa

DBGET integrated database retrieval system