KEGG   Shigella sp. PAMC 28760: A0259_14000
Entry
A0259_14000       CDS       T04390                                 

Definition
(GenBank) sugar polymerase
  KO
K23198  O7-antigen biosynthesis rhamnosyltransferase
Organism
shq  Shigella sp. PAMC 28760
Pathway
shq00542  O-Antigen repeat unit biosynthesis
Brite
KEGG Orthology (KO) [BR:shq00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00542 O-Antigen repeat unit biosynthesis
    A0259_14000
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:shq01005]
    A0259_14000
Lipopolysaccharide biosynthesis proteins [BR:shq01005]
 O-antigen repeat unit
  A0259_14000
SSDB
Motif
Pfam: DUF5889
Other DBs
NCBI-ProteinID: AMR23661
LinkDB
Position
complement(2784055..2784876)
AA seq 273 aa
MDCKKKLCIVACSYTLKPEFIINKLYNYLPDYELDGVVISNNHIVEQITMKGFHIENGTN
SLFEFSAYKEGIDFLEDSSLLPSGVPILILNDTLFLKHNAKFFLRKIVSYYSTIQRTELP
TMAGRLDPYNNICYSNSWNNMNGYISSFCMLINEKSAKIIVSCYNELPKYFFSNDIDIID
PKWGMQIESRLREFIRSHLIDIDTDTVWYQAKLLHNDKQRINIKAQCVFMEHFISGKIGE
SGIVVSIFPTWKGKVLNFLNEQLAKIKRKIIIK
NT seq 822 nt   +upstreamnt  +downstreamnt
atggattgtaaaaaaaaattatgcattgtggcctgttcttatactttaaagccagaattc
ataattaataaattatataattatttaccagattatgaactagatggtgttgtgatttcc
aataatcatatagtagaacagattacaatgaagggatttcatatcgaaaacgggacaaat
tctctttttgagttttctgcctataaggaaggaatagattttttagaagatagctcatta
ttaccatcaggagtaccaattctcattttgaatgatacattgttcttgaaacataatgca
aaattctttttaaggaaaattgtgagttattattcaacaattcaaagaactgaattgcct
acaatggcaggtcgtttagatccttataataatatatgttacagtaactcttggaataat
atgaatggctatatatcttccttttgtatgctaataaatgaaaaatctgcaaaaataatt
gttagttgctacaatgagcttccaaaatatttttttagtaatgatattgatattattgac
cccaaatggggaatgcagattgaatcaagactgagagaatttattcgtagtcatttaatt
gatatagacacagatacggtttggtatcaagctaaattgttacataatgataaacaacga
attaatattaaagctcaatgtgtcttcatggaacatttcatatcagggaagattggtgaa
agtggaattgttgtttctatttttcccacatggaaaggaaaggtgttaaattttttaaac
gagcaattggctaaaatcaagaggaagattataattaaatga

DBGET integrated database retrieval system