Sarcophilus harrisii (Tasmanian devil): 100914201 Help Entry 100914201         CDS       T02286                                  Symbol IL12A Name (RefSeq) interleukin-12 subunit alpha   KO K05406   interleukin 12A Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr04060   Cytokine-cytokine receptor interaction shr04620   Toll-like receptor signaling pathway shr04622   RIG-I-like receptor signaling pathway shr04625   C-type lectin receptor signaling pathway shr04630   JAK-STAT signaling pathway shr04658   Th1 and Th2 cell differentiation shr04936   Alcoholic liver disease shr04940   Type I diabetes mellitus shr05133   Pertussis shr05134   Legionellosis shr05140   Leishmaniasis shr05142   Chagas disease shr05143   African trypanosomiasis shr05144   Malaria shr05145   Toxoplasmosis shr05146   Amoebiasis shr05152   Tuberculosis shr05162   Measles shr05164   Influenza A shr05168   Herpes simplex virus 1 infection shr05171   Coronavirus disease - COVID-19 shr05200   Pathways in cancer shr05321   Inflammatory bowel disease shr05330   Allograft rejection shr05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:shr00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     100914201 (IL12A)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100914201 (IL12A)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100914201 (IL12A)    04622 RIG-I-like receptor signaling pathway     100914201 (IL12A)    04625 C-type lectin receptor signaling pathway     100914201 (IL12A)    04658 Th1 and Th2 cell differentiation     100914201 (IL12A)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100914201 (IL12A)   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     100914201 (IL12A)    05164 Influenza A     100914201 (IL12A)    05162 Measles     100914201 (IL12A)    05168 Herpes simplex virus 1 infection     100914201 (IL12A)   09171 Infectious disease: bacterial    05133 Pertussis     100914201 (IL12A)    05134 Legionellosis     100914201 (IL12A)    05152 Tuberculosis     100914201 (IL12A)   09174 Infectious disease: parasitic    05146 Amoebiasis     100914201 (IL12A)    05144 Malaria     100914201 (IL12A)    05145 Toxoplasmosis     100914201 (IL12A)    05140 Leishmaniasis     100914201 (IL12A)    05142 Chagas disease     100914201 (IL12A)    05143 African trypanosomiasis     100914201 (IL12A)   09163 Immune disease    05321 Inflammatory bowel disease     100914201 (IL12A)    05330 Allograft rejection     100914201 (IL12A)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     100914201 (IL12A)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     100914201 (IL12A)    04936 Alcoholic liver disease     100914201 (IL12A)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:shr04052]     100914201 (IL12A)    00536 Glycosaminoglycan binding proteins [BR:shr00536]     100914201 (IL12A) Cytokines and neuropeptides [BR:shr04052]  Cytokines   Interleukins    100914201 (IL12A) Glycosaminoglycan binding proteins [BR:shr00536]  Heparan sulfate / Heparin   Cytokines    100914201 (IL12A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL12 ALIX_LYPXL_bnd RHH_1 ASPRs Motif Other DBs NCBI-GeneID:  100914201 NCBI-ProteinID:  XP_031813449 UniProt:  G3VQT1 LinkDB All DBs Position 3:18200909..18208423 Genome browser AA seq 219 aa AA seqDB search MGPRRDAQLRYTFLIAILIGLSQVNWVKSIPVIQSEPSMHQYLRGSKNLLGTVTETLQQA RQKLELYSCSLEEIDHEDITESNTGRVCLPPELIKNGSCLDSKEKLSVKLCLKSIYKDLE TYKTEFKVVEETLAKDPTRQISLDQNMLAAIDEMMQALNFSSENMTVTPSPKEPDFYKAK VKLCLLLHAFRIRVVTIDRMRNYLCFLKDSSPSGFRSLG NT seq 660 nt NT seq  +upstreamnt  +downstreamnt atgggcccacgtcgcgacgctcagctccgatataccttcctcattgccatacttattggc cttagccaagtcaactgggtcaagagcattcctgtgatccagtctgaacccagcatgcac cagtatctcagaggctccaagaacctactggggaccgtcactgagactcttcagcaggca agacaaaaacttgaactttactcttgttccttggaagagatcgatcatgaagatatcacc gaaagcaacacaggcagggtctgcttacccccagaattgatcaagaatggaagttgcctg gattccaaagagaaactttccgttaagttgtgtcttaagagcatctataaggatctggag acttataagactgagtttaaagtggtcgaggaaactcttgcaaaggaccctacaaggcag atttctctggatcaaaatatgttggctgctattgatgagatgatgcaggccctgaatttc agtagtgaaaacatgacagtgaccccttcacccaaagaacctgacttctacaaggctaaa gtcaagctctgcctcctccttcatgcttttagaatccgggttgtgaccatcgatagaatg aggaactacctgtgcttcctaaaggactcatcacccagtggcttcaggtctttgggataa

DBGET integrated database retrieval system