Sarcophilus harrisii (Tasmanian devil): 100919026 Help Entry 100919026         CDS       T02286                                  Symbol MAX Name (RefSeq) protein max isoform X5   KO K04453   Max protein Organism shr  Sarcophilus harrisii (Tasmanian devil) Pathway shr03083   Polycomb repressive complex shr04010   MAPK signaling pathway shr05200   Pathways in cancer shr05202   Transcriptional misregulation in cancer shr05222   Small cell lung cancer Brite KEGG Orthology (KO) [BR:shr00001]  09120 Genetic Information Processing   09126 Chromosome    03083 Polycomb repressive complex     100919026 (MAX)  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     100919026 (MAX)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     100919026 (MAX)    05202 Transcriptional misregulation in cancer     100919026 (MAX)   09162 Cancer: specific types    05222 Small cell lung cancer     100919026 (MAX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:shr03000]     100919026 (MAX)    03036 Chromosome and associated proteins [BR:shr03036]     100919026 (MAX) Transcription factors [BR:shr03000]  Eukaryotic type   Basic helix-loop-helix/leucine zipper (bHLH-ZIP)    Cell cycle controlling factors, Mad/Max     100919026 (MAX) Chromosome and associated proteins [BR:shr03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.6)      100919026 (MAX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  100919026 NCBI-ProteinID:  XP_023358679 Ensembl:  ENSSHAG00000014285 LinkDB All DBs Position 2:complement(322949207..322988792) Genome browser AA seq 103 aa AA seqDB search MTSSGRMLYWSSKGKARADQVLCSWGIHFSSSLMEDASKRKFRALEKARSSAQLQTNYSS SDSSLYTNAKGSTISAFDGGSDSSSESEPEEPQSRKKLRMEAS NT seq 312 nt NT seq  +upstreamnt  +downstreamnt atgacctcaagcggcagaatgctctactggagcagcaaggggaaagcgagagctgatcaa gttctttgttcctggggaattcacttctcttcctccctcatggaagatgcaagtaaaagg aaattccgtgcactggagaaagcgaggtcaagtgcccaactgcagaccaactattcttct tcagacagcagcctctataccaatgccaagggcagcaccatctctgccttcgatgggggc tctgattccagctctgagtcagagcctgaagagccccaaagcagaaagaaactccggatg gaggccagctaa

DBGET integrated database retrieval system