KEGG   Sarcophilus harrisii (Tasmanian devil): 105749807
Entry
105749807         CDS       T02286                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
shr  Sarcophilus harrisii (Tasmanian devil)
Pathway
shr04927  Cortisol synthesis and secretion
shr04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:shr00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    105749807 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    105749807 (MRAP)
SSDB
Motif
Pfam: MRAP BTP
Other DBs
NCBI-GeneID: 105749807
NCBI-ProteinID: XP_012399857
LinkDB
Position
3:complement(245366339..245383256)
AA seq 156 aa
MANRTNSTDSNSYYGYEYYMDYVDLPQVDERKLKANKHSIVIAFWVSLAAFVVLLFLILL
YMSWSGSVPTRGSRSHCKCPWNYIFNLLFFVQKARGFQNSLTSTSQPQGQIKELEDGSSS
YEQPQGNNCIPDSVLIIVPQNTSPVQENEHYRGLVV
NT seq 471 nt   +upstreamnt  +downstreamnt
atggcaaacagaactaattctactgactccaactcctactatggctatgaatactatatg
gactatgtggaccttcctcaagtagatgaaagaaagttgaaggctaacaaacattcaatc
gtcattgctttttgggttagtcttgcagcttttgtggtacttctcttcctaattttgctc
tacatgtcctggtctggctcagttccaacaaggggttcccgttcacactgtaagtgccca
tggaattacatcttcaacttgctcttctttgtccaaaaggccagaggctttcaaaacagc
ctcaccagcacctcacagcctcaaggccaaatcaaagaactagaagatggaagctctagc
tatgagcagccacagggaaataactgcatcccggattctgttctaatcattgtccctcaa
aatacttctcctgtacaagaaaatgaacattatagaggcttggtggtctga

DBGET integrated database retrieval system