KEGG   Streptomyces hundungensis: DWB77_03335
Entry
DWB77_03335       CDS       T07388                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
shun  Streptomyces hundungensis
Pathway
shun01057  Biosynthesis of type II polyketide products
shun01100  Metabolic pathways
shun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shun00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    DWB77_03335
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:shun01008]
    DWB77_03335
Polyketide biosynthesis proteins [BR:shun01008]
 Polyketide tailoring proteins
  Others
   DWB77_03335
SSDB
Other DBs
NCBI-ProteinID: AYG81193
UniProt: A0A387HFX5
LinkDB
Position
3723544..3724578
AA seq 344 aa
MREISRGRLGATIATAALFAVAGAPTAWAGVTPGDGTRETDTPKGDAKPDGTLSATAGGV
VYDRSRNGSGSAVGPLAPVGNWTPPPCWYAPKYSPAEFKAYVEPIWSVDSTGAAWDASQR
DRYVNGKPYTNFNLDKAGKGYWWDSYVDTSYPPGWDACNKPYFWVDKGAPPPADVPEAIT
PEILAKLAYAEIRVPATQVTLKPDGTSKVNLPTWAWLDKTDFRPVSVTASVPALGISATT
TASPVSLKLEPGTADASLYPASGECPINADGSIGTPYEAGSADKAPPCGVTYRRATSGAP
YNLKATVTWKIHWVGTGTPGGDLPDGTFGHDQQVTVQEIQAVNR
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgcgtgaaataagcaggggacgactgggcgcgaccatagcgactgccgcgctcttcgcc
gtcgcgggtgcgcccaccgcgtgggccggggtcacccctggggacggcacccgggagacc
gatacgcccaagggcgacgcgaagccggacggcaccctcagcgccacggccggcggcgtg
gtctacgaccggtcgaggaacggctccggcagcgccgtgggccccctcgcccccgtcggc
aactggacgcctccaccctgctggtacgcccccaagtacagccctgcggagttcaaggcg
tacgtcgagccgatctggagcgtcgactccaccggcgccgcctgggacgcctcgcagcgc
gatcgctacgtcaatggaaagccctacaccaacttcaacctggacaaggcgggcaagggc
tactggtgggactcgtacgtcgacacgagctatccaccgggctgggacgcctgcaacaag
ccctacttctgggtcgacaagggcgcaccgccgcccgccgacgtgcccgaagccatcact
cccgagatcctcgccaagctggcgtacgcggagattcgcgtaccggccacccaggtgacc
ctgaagcccgacggcaccagcaaggtgaacctgccgacctgggcgtggctggacaagacc
gacttccgccccgtctcggtcaccgcgtccgtccccgcgctcggcatctcggcgaccacg
accgcctccccggtctccctcaaactggagcccggtaccgccgacgccagcctctacccc
gcttccggcgagtgccccatcaacgcggacggctccatcggcacgccgtacgaggcgggc
agcgccgacaaggccccgccctgcggcgtgacataccgccgagctaccagcggtgccccc
tacaacctgaaggccaccgtcacctggaagatccactgggtcgggaccggcacgccaggc
ggtgatctgccggacggcaccttcggccatgaccagcaggtgaccgtgcaggagatccag
gcggtcaaccgctga

DBGET integrated database retrieval system