KEGG   Streptomyces hundungensis: DWB77_06762
Entry
DWB77_06762       CDS       T07388                                 

Name
(GenBank) Cytochrome P450 105A3
  KO
K21146  vitamin D 1,25-hydroxylase [EC:1.14.15.22]
Organism
shun  Streptomyces hundungensis
Pathway
shun00100  Steroid biosynthesis
shun01100  Metabolic pathways
shun01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:shun00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    DWB77_06762
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:shun00199]
    DWB77_06762
Enzymes [BR:shun01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.22  vitamin D 1,25-hydroxylase
     DWB77_06762
Cytochrome P450 [BR:shun00199]
 Cytochrome P450, bacteria type
  CYP105 family
   DWB77_06762
SSDB
Motif
Pfam: p450 Mucin
Other DBs
NCBI-ProteinID: AYG84548
UniProt: A0A387HRS9
LinkDB
Position
7532839..7534158
AA seq 439 aa
MDSMTHTTEATNTAEATNTAEATEATNTAEATEATDTAASLQTGEAPAFPADRTCPYQLP
QLYSELRDNPGALRAVTLFDGRRAWVVTKHEAARKLLADPRLSSDRTHDQFPATIPRFKA
FRDGRPSFIGMDPPEHGTRRRMMISEFTVKRIKSMRPDVERIVHGFIDEMLAGGPPADLV
AQFALPVPSMVICELLGVPYAAHDFFQDASRRLVQSADASAAIAARDDLNHYLDGLITRM
RTEPGPGLLNALVARQLAAGEIDREELVSTALLLLVAGHETTASMTSLGVITLLEHPDQH
AALRADPTLVPNAVEELLRYLAIADIAGGRVATADIEIDGQHIRAGEGVLVVNSLANRDG
SVFEDPDSLDVHRTARHHLSFGFGVHQCLGQNLARLELEVILTALFDRIPTLRLAVPVER
LTLRPGTTIQGVNELPVTW
NT seq 1320 nt   +upstreamnt  +downstreamnt
atggattcgatgacccatacgaccgaagcgaccaatacggccgaagcgaccaatacggcc
gaagcgaccgaagcgaccaatacggccgaagcgaccgaagcgaccgacaccgccgcgtcg
ttgcagacgggcgaggctcccgccttcccggccgaccgcacctgcccctaccaactgccg
cagctctacagcgagttacgcgacaatcccggcgccctgcgcgccgtgaccctcttcgac
ggccgacgggcctgggtggtgaccaagcacgaggccgcgcgtaagttactcgccgatccc
cggttgtcctccgaccgcacccacgaccaattcccggccacaatcccccggttcaaggcc
ttccgcgacggtcgcccgtcgttcatcggcatggacccgcccgagcacggcacccgccga
cgcatgatgatcagcgagttcaccgtgaagcggatcaagagcatgcggccggacgtcgag
cgcatcgtgcacggtttcatcgacgagatgctcgccggagggccgcccgccgacttggtc
gcccagttcgctctgcccgtcccctccatggtgatctgcgaactgctcggcgtcccgtac
gcggcccacgacttcttccaggacgcgagcaggcgcttggtgcagtcggcggacgcgagc
gccgcgatcgccgctcgcgacgacctgaaccactacctggacggcctcatcacgaggatg
cggacggagccgggccccggcctcctgaacgccctggtggcacggcagttggccgccgga
gagatcgaccgcgaggaactggtctcgaccgccctgctactgctcgtcgccggtcacgag
accaccgcctcgatgacctcgctcggcgtgatcaccctgctggaacaccccgatcagcac
gccgccctgagggccgatccgacgctggtgcccaacgccgtcgaagaactcctgcgctac
ctcgcgatcgccgacatcgcgggcggtcgcgtggccacggcggacatcgagatcgacggg
cagcacatccgcgcgggcgagggtgtgctggtcgtcaactcccttgccaatcgggacggt
tcggtcttcgaggaccctgactccctcgatgtgcaccgtacggcacgccaccatctgtcc
ttcggcttcggggtgcatcagtgcctcggccagaacctggcccgcctggaactcgaagtc
atcctcaccgccttgttcgaccgtatcccgaccttgcgcctcgccgtccccgtggagcgg
ctcaccctgcgtccgggcacgacgatccagggcgtcaacgagctgccggtcacctggtga

DBGET integrated database retrieval system