KEGG   Streptomyces inhibens: KI385_25145
Entry
KI385_25145       CDS       T08140                                 
Name
(GenBank) SRPBCC family protein
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
sine  Streptomyces inhibens
Pathway
sine01056  Biosynthesis of type II polyketide backbone
sine01100  Metabolic pathways
sine01110  Biosynthesis of secondary metabolites
Module
sine_M00778  Type II polyketide backbone biosynthesis, acyl-CoA + malonyl-CoA => polyketide
Brite
KEGG Orthology (KO) [BR:sine00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    KI385_25145
Enzymes [BR:sine01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     KI385_25145
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc Linocin_M18 HetR_C
Other DBs
NCBI-ProteinID: UKY51768
LinkDB
Position
complement(5494581..5495540)
AA seq 319 aa
MANLPNNTAHPHTVEDTVVIAAPAAAVRELILDVEAWPQLHRPAVHAEILESSEDGDLIQ
HWSVVDDHTVRTWTMRRNVVGENITFAHEPASAPFADVVGGWTVQEQPDGSTSVRMFHEF
TLIEENAETVAQKTESMRRGAADYLKTLKFAAENAADLEERIISFEDPLFVAGSVEDAYR
YLYEADKWAERIPHVIRLELEENTPNIQFFDMDTKSSDGSEHTTRSVRICLPNNKIVYKQ
TTPPKTLDAHTGHWLFTETPEGVIVSSRHTATIRPEGLNLLGEGTTVQGARKYLRRVLSA
NSMGNLRLTKVYAEERAGV
NT seq 960 nt   +upstreamnt  +downstreamnt
gtggcgaatctgccgaacaacaccgcccatccgcacaccgtcgaggacacggtggtgatc
gcggctccggccgcagccgtccgtgaactgatcctcgacgtcgaggcatggccccagctg
caccgtcccgccgtgcacgccgagatcctggagagctctgaggacggcgatctcatccag
cactggtccgtggtcgacgaccacaccgtacgcacctggaccatgcgccgtaacgtcgtg
ggcgaaaacatcaccttcgcccatgagccggcctcggccccgttcgccgatgtggtcggc
ggctggaccgtccaggagcagcccgacggatcgacgtcggtgcggatgttccacgagttc
acgctgatcgaggagaacgccgagaccgtcgcgcagaagaccgagtcgatgcgccgcggt
gccgcggactacctcaagacgctgaagttcgcggcggagaacgcggccgacctggaggag
cggatcatcagcttcgaggacccgttgttcgtggcagggtcggtcgaggacgcctaccgg
tacctgtacgaggcggacaagtgggcggagcgaatcccccacgtgatccgtctggagctg
gaggagaacactccgaacatccagttcttcgacatggacacgaagtcctcggacggttcc
gagcacaccacccgctcggtgcgtatctgcctgccgaacaacaagatcgtgtacaagcag
accacgccgccgaagacgctggacgcgcacaccggccactggctgttcaccgagacgccc
gagggcgtcatcgtcagctcccggcacaccgcgaccatccgcccggagggcctgaacctg
ctcggtgaaggcaccacggtccagggtgcccggaagtacctgcgccgtgtcctgagcgcc
aacagcatgggcaacctgcggctgacgaaggtctacgcggaagagcgcgcgggagtgtga

DBGET integrated database retrieval system