KEGG   Sellimonas intestinalis: K5I26_06370
Entry
K5I26_06370       CDS       T08070                                 
Name
(GenBank) acylneuraminate cytidylyltransferase family protein
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
sint  Sellimonas intestinalis
Pathway
sint00541  O-Antigen nucleotide sugar biosynthesis
sint01100  Metabolic pathways
sint01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:sint00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    K5I26_06370
SSDB
Motif
Pfam: CTP_transf_3 NTP_transf_3
Other DBs
NCBI-ProteinID: UOX63680
LinkDB
Position
1340072..1340752
AA seq 226 aa
MNNLAIIPARSGSKGLKDKNIKLLNGKPLMAYSIDAAKKSGIYSHILVSTDSEKYKIIAE
KCGAEVPFYRSEENSSDIASSWDVVSEVLKNYKQLGVEFDTFTLLQPTSPLRDDQDIKKA
YHLLYEKKAIGVVSVCEMEHSPLWSNVLPEDGSLEGFLDFSSNKQRQKLQKFYRVNGAIY
MAKVKEFLENQNLYRSKCYAYKMTTEKSIDIDTALDFKIAEIILRG
NT seq 681 nt   +upstreamnt  +downstreamnt
atgaataatttagcaattataccagcacgtagtggttcaaaaggacttaaagataaaaat
attaaactactaaacggaaagccactaatggcatatagcattgatgcagcgaaaaaatct
ggaatatattctcatattttagtatctactgattcggaaaagtacaagataatagcggaa
aagtgtggggcagaagttccattttatcgctctgaggaaaactcgtctgatatagcatct
tcatgggatgttgtatccgaggttctgaaaaattataagcaactgggagtagagttcgat
acctttacgttgctacaacccacatcacctttacgtgacgatcaggatatcaaaaaagct
tatcatttgttgtatgaaaaaaaagcaataggagtagtgtctgtttgtgaaatggaacac
tccccgctttggagtaatgttcttccagaggatggttctttagaaggttttttggatttt
tcttctaataagcaaagacaaaaactacagaagttttacagagttaatggagctatatat
atggcaaaagtaaaagagtttttagaaaatcaaaatctttatcgatcaaaatgttatgcg
tataaaatgacaacagagaaaagtattgacatagacacggctttggattttaaaattgcg
gaaatcattttaagaggatga

DBGET integrated database retrieval system