KEGG   Setaria italica (foxtail millet): 101776721
Entry
101776721         CDS       T02818                                 

Name
(RefSeq) P-(S)-hydroxymandelonitrile lyase
  KO
K08249  hydroxymandelonitrile lyase [EC:4.1.2.11]
Organism
sita  Setaria italica (foxtail millet)
Pathway
sita00460  Cyanoamino acid metabolism
sita01100  Metabolic pathways
sita01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sita00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    101776721
Enzymes [BR:sita01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.11  hydroxymandelonitrile lyase
     101776721
SSDB
Motif
Pfam: Peptidase_S10
Other DBs
NCBI-GeneID: 101776721
NCBI-ProteinID: XP_004979757
UniProt: K3ZI70
LinkDB
Position
VIII:complement(34674545..34680577)
AA seq 493 aa
MAASSSCHCSPLLLALAAGLLILLVPPLASGSSHENSQEEDRILGMPGQPNDGVAFDMYG
GYVTVDEGAGRALYYWFQEADRATADPATAPLVLWLNGGPGCSSVGSGAFEELGAFRVNT
DGQTLLLNEFAWNKAANVLFLESPAGVGFSYSNTSSDLVVGDDRTARDSYIFLVKWFERF
PQYKYRDFYIAGESYAGHYVPQLSQLVYRNNIGVEKPFINFKGFMVGNGLIDDLTDMIGM
LEYWWHHGLISDETLASGLDVCLGSSLIHPSPECQKICDVQAAKEMGKIDGYSIYTPPCE
RGNPYDRMLERSRRPLMLPPYDPCTAWYSTNYLNIPEVQNAMHANVSGMIKYPWTMCNNP
IYDNWTTITPNVSMIPIYKELIGVGLKIWVFSGDTDTAVPLSSTRRSLAALGLPVKTSWY
PWYMVPTEVGGWSMEYDGLTYVTVRGAGHEVPLHRPEQALVLFKQFLLGEPMPAEAPKDA
SVILLPSEKAPSY
NT seq 1482 nt   +upstreamnt  +downstreamnt
atggctgctagcagctcctgccactgctctccactactcctcgccttggccgctggcctc
ctaatcctcctggtgccgccactggcaagtgggtcgtcccacgagaactcgcaggaggag
gaccgcatcctggggatgccggggcagcccaacgacggcgtggcgttcgacatgtacggc
ggctacgtcaccgtcgacgagggcgccggccgcgcgctctactactggttccaggaggca
gaccgcgccacggccgacccggccaccgcgccgctcgtcctctggctcaacggcgggccc
gggtgctcctccgtcggctccggcgcgttcgaggagctcggcgcgttccgcgtcaacacc
gacggacagacgctcctgctcaacgagttcgcttggaacaaagcggcgaacgtactgttc
ttggagtcgccggccggcgtggggttctcttacagcaacaccagctctgacctcgttgtt
ggcgacgacagaacggcacgtgactcgtacattttcctggtgaaatggttcgagagattc
ccgcagtacaagtaccgtgatttctacattgcaggagagagctatgcaggtcactatgtt
cctcagctgtcccagcttgtgtacaggaacaacatcggcgtagagaagcctttcatcaac
ttcaaaggtttcatggtcggtaacggcctgatcgacgacctcaccgacatgatcggcatg
ctcgagtactggtggcaccacggcctcatctccgacgagaccctggcgagcgggctcgat
gtctgcctgggtagctccttgatccacccctcgccggagtgccagaagatctgcgacgtg
caggccgcgaaggagatgggcaagatcgacggctacagcatctacacgccgccgtgcgag
agggggaacccatacgatcgcatgctcgagcggagccgccgcccattgatgttgccgccc
tacgacccgtgcacggcctggtactcgaccaactacctgaacatccccgaggtgcagaac
gccatgcacgccaacgtcagcggcatgataaagtacccgtggacgatgtgcaacaatccc
atttatgataactggacgacaatcacgcctaatgtttccatgatacccatctacaaggag
ctcattggagttggcctcaagatctgggtcttcagtggtgacacagacactgcagtgccg
ctgagctcgaccaggcgctcccttgctgccctgggccttcctgttaagaccagctggtat
ccctggtacatggtcccaactgaggttggtggctggagcatggagtatgacggcctgacc
tacgtcaccgtccgcggcgccgggcacgaggttcccctgcaccgtccggagcaggcactc
gtcctgttcaagcagttcctgctgggcgaacccatgccggccgaggcaccaaaagatgcc
agcgtcatcctacttcctagtgagaaagctccctcctactga

DBGET integrated database retrieval system