Streptomyces violaceus: RI060_04995 Help Entry RI060_04995       CDS       T09385                                  Name (GenBank) MbtH family protein   KO K05375   MbtH protein Organism sjn  Streptomyces violaceus Pathway sjn00261   Monobactam biosynthesis sjn01100   Metabolic pathways sjn01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sjn00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00261 Monobactam biosynthesis     RI060_04995  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:sjn01008]     RI060_04995 Polyketide biosynthesis proteins [BR:sjn01008]  Nonribosomal peptide synthetase (NRPS)   Linear NRPS    Nocardicin synthetase     RI060_04995 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MbtH Motif Other DBs NCBI-ProteinID:  WND16754 UniProt:  A0ABY9U1U1 LinkDB All DBs Position complement(1080354..1080566) Genome browser AA seq 70 aa AA seqDB search MSTNPFDDNEGRFLVLVNDEGQHSLWPSFAEVPGGWTIAFAENTRDACLEYVETHWTDLR PRSLAATMDV NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgagcaccaaccccttcgacgacaacgaaggccgtttcctggtcctggtgaacgacgag ggccagcactcactctggccgtcgttcgccgaggtgcccgggggatggacgatcgccttc gccgagaacacccgggacgcgtgcctggagtacgtcgagacccactggacggacctgcgc ccccggtccctcgccgcgacgatggacgtctga

DBGET integrated database retrieval system