KEGG   Sphingobium japonicum: SJA_C1-21150
Entry
SJA_C1-21150      CDS       T01201                                 
Symbol
tfdC
Name
(GenBank) chlorocatechol 1,2-dioxygenase
  KO
K15253  chlorocatechol 1,2-dioxygenase [EC:1.13.11.-]
Organism
sjp  Sphingobium japonicum
Pathway
sjp00361  Chlorocyclohexane and chlorobenzene degradation
sjp01100  Metabolic pathways
sjp01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sjp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    SJA_C1-21150 (tfdC)
Enzymes [BR:sjp01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     SJA_C1-21150 (tfdC)
SSDB
Motif
Pfam: Dioxygenase_C CarboxypepD_reg Dioxygenase_N DUF3209 DUF2520
Other DBs
NCBI-ProteinID: BAI96949
NITE: SJA_C1-21150
UniProt: D4Z2W7
LinkDB
Position
1:2112781..2113536
AA seq 251 aa
MPMESEQLEAVVMDIVAGIRDAIIKHHVTVDQYRFAVDYLGRLADARELPLLLDVFLNVA
AVDAENEVTKGSPQAIQGPYYREDAPAVTDRLKTLDHDNERPLVVRGQVRDIDGSVLPGA
EVDIWHSTPTGKYSGFHDNIPVDYYRGKLTSDSEGAYRVATTAPVPYQIPNQGYTGALLE
AMGRHSWRPAHVHFKVRKPGFKTVTTQVYFEGGQWVDSDCCSGVRDDLVRRTTQEDGVDT
LTVDFVLDRAA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgccgatggagtccgaacagcttgaggccgtagtgatggatatcgtcgcgggaatacgc
gacgccatcataaagcatcatgtgacggtcgatcagtaccgcttcgccgtcgactatctc
ggccggctggcggacgccagggaactgccgctgctcctcgacgtcttcctgaacgtggcc
gcggtcgacgcggaaaacgaggtgacgaagggttctccgcaggcgatccaggggccctat
tacagggaggatgcgcccgccgtcaccgaccggctcaagaccctcgatcatgacaatgag
cgtccgctcgtcgtccggggccaggtgcgcgacatcgatgggtccgtcctgcccggagcg
gaggtcgacatctggcactcgaccccgaccggaaaatatagcgggttccacgacaatatc
cccgtcgattattatcggggcaagctgacgtcggacagcgaaggcgcctatcgcgtcgcg
accacggcgccggttccctaccagatccccaaccagggctataccggcgcgctgctggag
gcgatgggacgccatagctggcgccccgcgcacgtccacttcaaggtgcgcaagcccggg
ttcaagacggtcacgacccaggtctatttcgagggcggacaatgggtcgacagcgattgc
tgcagcggcgtgcgcgacgatctggtccgccggacgacgcaggaggacggcgtcgatacg
ctgacggtcgacttcgttctcgaccgcgcggcctga

DBGET integrated database retrieval system