KEGG   Streptomyces koyangensis: D0C37_12035
Entry
D0C37_12035       CDS       T06436                                 
Name
(GenBank) hypothetical protein
  KO
K14628  enoyl reductase
Organism
sky  Streptomyces koyangensis
Pathway
sky01100  Metabolic pathways
sky01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sky00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01057 Biosynthesis of type II polyketide products
    D0C37_12035
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sky01008]
    D0C37_12035
Polyketide biosynthesis proteins [BR:sky01008]
 Polyketide tailoring proteins
  Others
   D0C37_12035
SSDB
Other DBs
NCBI-ProteinID: AXQ58931
UniProt: A0A385DMA7
LinkDB
Position
complement(2839192..2840163)
AA seq 323 aa
MAVAGPAHADKGFGETDGGGGTDTGAGVDGDTVSVTAGGVVYDRSKNGGGGSSGALTSTT
SWSPPACWYAPKYTPEQLQEHLEPIWEADSTGYEWDAAQREKYNAADEEKGFNKHKSGKG
YWWDSYVNDDFPPGWEACDEGPFWVDTGDAPPAAMENAVTPAILAQLAYAQVRVPGTEVT
LAPADTTKVNLPTWAWLDGADFKPVSVTASVPALGIEATATAEPVSLTIEPGTPDADTYP
ASGTCALTDGRIGEPYAKGKADRTPPCGVKYERSSGDATFPLQATLTWKVTWTGSDGDGG
DLPDGEFGATQDVVVQEIQAINR
NT seq 972 nt   +upstreamnt  +downstreamnt
ctggccgtcgccggccccgcccacgccgacaagggattcggcgagacggacggcgggggc
ggcacggacaccggcgcgggcgtcgacggggacaccgtctccgtcaccgccgggggcgtc
gtctacgaccgttcgaagaacggcggcggcggctcgtccggcgccctgacctccacgacc
tcctggtcgccgcccgcctgctggtacgccccgaagtacaccccggagcagttgcaggag
cacctggagccgatctgggaggccgattccacggggtacgagtgggacgcggcacagcgg
gagaagtacaacgccgccgacgaggagaagggcttcaacaagcacaagtcgggcaagggc
tactggtgggactcgtacgtcaacgacgacttcccgcctggctgggaggcctgtgacgag
gggcccttctgggtcgacacgggcgacgccccgcccgccgccatggagaacgccgtcacc
cccgccatcctcgcccaactcgcctacgcccaggtccgggtccccggcaccgaggtgacc
ctggctcccgccgacacgacgaaggtcaacctgcccacctgggcctggctggacggcgcc
gacttcaagcccgtctccgtcacggcctcggtcccggccctcggcatcgaggcgaccgcc
accgccgaaccggtctcgctcaccatcgagccgggcacgccggacgccgacacctacccc
gcctccggcacctgcgccctcaccgacggccgcatcggcgagccgtacgccaagggcaag
gccgaccgcacacctccctgcggcgtgaagtacgagcgttcctcgggcgacgccacgttc
cccctccaggccaccctcacctggaaggtcacctggaccggcagcgacggggacggcggc
gacctgcccgacggggagttcggggctacgcaggatgtggtggttcaggagatccaggcg
atcaatcggtga

DBGET integrated database retrieval system