KEGG   Streptomyces liliifuscus: JEQ17_02515
Entry
JEQ17_02515       CDS       T08169                                 
Name
(GenBank) beta-ketoacyl-[acyl-carrier-protein] synthase family protein
  KO
K21789  dodecanoy-ACP synthase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02515
SSDB
Motif
Pfam: ketoacyl-synt Ketoacyl-synt_C Thiolase_N KAsynt_C_assoc
Other DBs
NCBI-ProteinID: QQM38454
UniProt: A0A7T7HZW6
LinkDB
Position
complement(574719..575957)
AA seq 412 aa
MTTPVSPSPDIAVTGVGLVTSAGIGVDATWKGVCEGRPTAARNPLLAGLPVDISCTVPGF
SAREHVGRRSSLAHDRFTQLGITAAREAVADAGLDPRNWDGARVGVVVGCGLGGVATWET
QHRRMLEKGPEAVSALLIPMLVPNMVAGHLAMDLHATGPNLVTATACASGATAIGTALQL
LRDGSCDLVVAGGAEAGVSPLMVTGFAQMGALSRRLDEPSAASRPFDADRDGFVIGEGSG
MLVLEREADAHARRARVRARIAGYGASADAYQMTAPDPAGVGVLQALRTALAGAGVMPDE
VDHVNAHGTSTPLNDAAEAGALRKLLGEGAAVTSTKGVTGHTLGAAGAIEAVLTVLTVEH
GRVPPTANLERQDAEIELDIVAGSPREQKVDVAVSNSFGFGGQNAVLVITAA
NT seq 1239 nt   +upstreamnt  +downstreamnt
atgaccacgcccgtatccccgtcgccggacatcgcggtgaccggtgtcggtctggtcact
tccgccggcatcggagtggacgccacctggaagggcgtgtgcgaaggtcggcccacggcg
gcccggaacccgctgctggccggacttcccgtggacatctcctgcaccgtgcccggcttc
tcggcccgcgaacacgtgggcaggcgcagctccctggcgcacgaccgcttcacccagctc
ggcatcaccgcggcacgtgaggcggtcgccgacgccggcctggatccgcggaactgggac
ggcgctcgcgtcggggtcgtcgtcggatgtggcctcggcggtgtggcgacatgggaaacc
cagcacaggcggatgctggagaaggggccggaagcggtgtccgccctgctgatcccgatg
ctggtgcccaacatggtcgccggacacctggcgatggacctgcacgccacgggcccgaat
ctcgtcacggcgacggcctgcgcatccggcgcgacggcgatcggcacggccctgcagctg
ctgcgcgacggaagctgcgacctggtcgtcgccggtggcgccgaggccggggtcagcccg
ctcatggtgacgggcttcgcccagatgggcgcgctctccaggagactcgacgaaccgtcc
gccgcgtcccgcccgttcgacgcggaccgcgacgggttcgtcatcggcgagggcagcggc
atgctcgtcctcgaacgcgaggcggacgcacatgcccgccgggcgcgggtccgggccagg
atcgccgggtacggagcctccgccgacgcctaccagatgaccgccccggacccggcgggc
gtcggtgtcctgcaagccctgcgcacggccttggccggagcgggggtcatgcccgacgag
gtcgaccatgtcaacgcgcacggcacctcgacgccgctcaacgacgcggcggaggcagga
gcactgcgcaaactcctcggcgaaggcgccgcggtcacatccaccaagggggtgaccggc
cacaccctgggagcggccggcgcgatcgaagccgtgctgaccgtcctgaccgtcgagcac
ggcagagtacccccgaccgccaacctcgaacggcaggacgccgagatcgagttggacatc
gtcgccggatcgccacgtgagcagaaggtggacgtcgcggtgagcaactcgttcggcttc
ggcggccagaacgcggtcctggtcatcacggccgcctga

KEGG   Streptomyces liliifuscus: JEQ17_02520
Entry
JEQ17_02520       CDS       T08169                                 
Name
(GenBank) acyl carrier protein
  KO
K21790  acyl carrier protein
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02520
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: QQM38455
UniProt: A0A7T7HZY4
LinkDB
Position
complement(575954..576202)
AA seq 82 aa
MSVMYGRLVDLLVDRFEVDRAEISADTTFEDLDMDSLFLVELLLVIQSEFGVDVGDDAAS
PGDTITAVADLIERLASAEASA
NT seq 249 nt   +upstreamnt  +downstreamnt
atgagcgtgatgtacggcaggctggtcgatcttctggtcgaccgattcgaggtggaccgt
gcggagatcagcgccgacaccacgttcgaggatctcgacatggactcgctgttcctcgtg
gaactgctcctggtgatccagtccgagttcggtgtggacgtcggggacgacgccgcgtct
cccggggacacgatcacggctgtcgccgacctgatcgagcgcctcgcgtccgccgaggcc
tcagcatga

KEGG   Streptomyces liliifuscus: JEQ17_02525
Entry
JEQ17_02525       CDS       T08169                                 
Name
(GenBank) ketoacyl-ACP synthase III
  KO
K21788  dodecanoy-ACP synthase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02525
SSDB
Motif
Pfam: ACP_syn_III_C ACP_syn_III Thiolase_N Chal_sti_synt_N FAE1_CUT1_RppA
Other DBs
NCBI-ProteinID: QQM38456
UniProt: A0A7T7HZX1
LinkDB
Position
576566..577567
AA seq 333 aa
MSRAAVLTGVGSCLPPRAVSNDELAAGLGSSDEWIRSRTGIEQRYFAEQGTATSDLAVGA
GEKALKSAGVSAVDMVLVATTTPDRPCPATAPTVAARLGMRGTAAYDVSAVCTGFVYGLA
TAAGLISARVADRVLVIGAETFSTLLNPEDRSTAVIFGDGAGAVVLRSGDPREPGALGPF
DLGSDGAGEDLISVSAGGSRQRLSGADPAADDRYFTMSGKEVFRHAVRRMTGSARTVLAR
ADWDAQDIDHLVSHQANLRITHHVADSLRIPRDRCVSNIAEVGNTAAASIPLALDQAHAE
GTLRPGGRLLLTAFGGGLTWGSAVLTWPELDRF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgagtcgggccgccgtgttgaccggggtcggcagctgcctgccgcccagggccgtgtcc
aacgacgaactggccgccggactcggcagttcggatgagtggatccggtcgcgcacaggt
atcgagcagcggtacttcgcggagcaggggacggcgacctccgatctggccgtcggggcg
ggcgagaaggccctgaagagcgcgggggtctccgccgtggacatggtgctcgtcgccacc
accacgcccgatcgcccctgtccggcgaccgcgccgacggtggccgcccggctcgggatg
agggggaccgccgcctacgacgtgtccgccgtctgcaccgggttcgtctatgggctggcg
accgcggcggggctcatatccgcccgggtcgccgaccgggtgctggtgatcggcgcggag
acgttctccaccctgctcaatcccgaggaccggtccaccgccgtgatcttcggagacggc
gccggcgccgtcgtactgcgctcgggggatccgcgggaacccggcgcgctcggccccttc
gacctggggagcgacggagcgggcgaggacctgatcagcgtgtcggcgggcggctcgcgc
cagcgcctgtccggagcggatcccgccgccgacgaccggtacttcacgatgtccggcaag
gaggtcttccggcatgcggtgcgacggatgaccggatcggcccgcacggtcctcgcgcga
gcggactgggatgcgcaggacatcgaccatctggtgagtcatcaggccaacctccggatc
acccatcacgtcgccgacagcctccggatccccagggaccgctgcgtcagcaacatcgcc
gaggtcggtaacacggcggccgcctccatccctctcgcgctcgaccaggcacacgcggag
ggcacgttgcgtccgggtggacggctgctgctcacggcgttcggaggcgggctcacctgg
gggtcggcggtactgacgtggccggaactggaccgtttctga

KEGG   Streptomyces liliifuscus: JEQ17_02530
Entry
JEQ17_02530       CDS       T08169                                 
Name
(GenBank) acyl carrier protein
  KO
K21790  acyl carrier protein
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02530
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: QQM38457
UniProt: A0A7T7HZY4
LinkDB
Position
577591..577839
AA seq 82 aa
MSVMYGRLVDLLVDRFEVDRAEISADTTFEDLDMDSLFLVELLLVIQSEFGVDVGDDAAS
PGDTITAVADLIERLASAEASA
NT seq 249 nt   +upstreamnt  +downstreamnt
atgagcgtgatgtacggcaggctggtcgatcttctggtcgaccgattcgaggtggaccgt
gcggagatcagcgccgacaccacgttcgaggatctcgacatggactcgctgttcctcgtg
gaactgctcctggtgatccagtccgagttcggtgtggacgtcggcgacgacgccgcgtct
cccggggacacgatcacggctgtcgccgacctgatcgagcgcctcgcgtccgccgaggcc
tcagcatga

KEGG   Streptomyces liliifuscus: JEQ17_03845
Entry
JEQ17_03845       CDS       T08169                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-ACP reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_03845 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_03845 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_03845 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_03845 (fabG)
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_03845 (fabG)
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_03845 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N
Other DBs
NCBI-ProteinID: QQM38682
UniProt: A0A7T7I0V6
LinkDB
Position
complement(894713..895459)
AA seq 248 aa
MGLLDGRNAVITGGAQGIGFEIAGVLGGAGASVVIGDINEDAAAQAAERLAKDGVAATSL
RCDVTDEDEVGALVAHGTDVFGPVGVMVNNAGITRDATLRKMALADFRAVVDVHLTGAWN
GTRYAAEAMRAHGRGGSIVNISSIAGKVGNFGQTNYSAAKAGLVGLTKASAKELAKSGVR
VNAVQPGLIRTAMTEAMPRAAWDAKLAEIPMARAGEPAEVAQVVLFLASDMASYITGAVV
EVTGGRYM
NT seq 747 nt   +upstreamnt  +downstreamnt
atgggactgctggacggccggaacgccgtgatcaccggcggcgcacagggcatcggcttc
gagatcgccggcgtgctcggcggggcgggagcgtccgtcgtcatcggcgacatcaacgag
gacgccgcggcccaggccgccgaacgcctggccaaggacggcgtggccgccacctcgctg
cgctgcgacgtcaccgacgaggacgaggtgggcgctctcgtcgcccatggcaccgacgtg
ttcggaccggtcggcgtcatggtcaacaacgccgggatcacccgcgacgcgaccctgcgc
aagatggccctcgccgacttccgcgccgtcgtcgacgtccatctcaccggagcctggaac
ggcacccggtacgccgccgaggccatgcgcgcccatggccggggcggcagcatcgtcaac
atctcctccatcgccggcaaggtcggcaacttcgggcagaccaactacagcgcggccaag
gccgggctcgtcggcctcaccaaggcttccgccaaggagctcgcgaagtctggcgtccgc
gtcaacgccgtgcagcccgggctgatccgcaccgcgatgaccgaggcgatgccccgggcc
gcctgggacgcgaaactcgccgagatccccatggcccgcgcgggcgaacccgccgaggtc
gcccaggtagtcctcttcctcgcctccgacatggcgagctacatcaccggagccgtggtc
gaggtgaccggcggccggtacatgtga

KEGG   Streptomyces liliifuscus: JEQ17_07140
Entry
JEQ17_07140       CDS       T08169                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_07140
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_07140
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_07140
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_07140
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_07140
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_07140
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: QQM39261
UniProt: A0A7T7KUS4
LinkDB
Position
1650608..1651420
AA seq 270 aa
MSIPNPAATNPVENVGGVENAKVPGERARPRVAVVTGGSRGIGRRAVARLASDGFAVVAG
YSGNADLAEAAVEEVTAAGGRAIAVRGDVADENDMSALFDLAESTYGGVDVVVHAAGRAR
TAAVVDLDLADLDALHRTNIRGTFVVAQQAARRVRPGGAIITFSTSVVGLAFPTYGAYSA
SKGAVEALTLILARELRGRDVTVNAVAPGPTATDLFLDGKDEETIARLAAQPPLERLGSP
ADIAETVAFLVSPAGHWINGQVVRANGGIV
NT seq 813 nt   +upstreamnt  +downstreamnt
atgtccattccgaatccggcggcgacgaatccagtggagaacgtggggggcgtggagaac
gcgaaggtgccgggtgagcgcgcccgcccccgtgtcgccgtcgtcacgggcggctcgcgc
ggaatcggccgccgggccgtggcccgcctggcgtccgacgggttcgcggtcgtggccggc
tactcgggcaacgctgacctcgccgaggccgcggtcgaggaggtcaccgcggccggcggc
cgggccatcgccgtacgcggggacgtcgccgacgagaacgacatgtccgcgctgttcgac
ctggccgagtccacgtacggcggtgtcgacgtggtcgtccacgcggcgggccgggcccgc
acggcggccgtcgtcgacctggacctggccgatctggacgcgctgcaccgcaccaacatc
cgcggcacgttcgtcgtcgcccagcaggccgcccgaagggtccggccgggcggcgccatc
atcaccttctccacgtccgtcgtcggtctcgcgtttcccacgtacggggcctacagcgcg
agcaagggagcggtggaggcgctgacgctgatcctcgcccgcgaactgcgcggccgggac
gtgacggtgaacgccgtcgcccccggtcccaccgcgacggatctgttcctcgacggcaag
gacgaggagaccatcgcccggctggccgcccagcctccgctggaacgcctcggctccccg
gccgacatcgccgagacggtcgcgttcctcgtctccccggccggccactggatcaacgga
caggtcgtccgggccaacggcggcatcgtctga

KEGG   Streptomyces liliifuscus: JEQ17_10940
Entry
JEQ17_10940       CDS       T08169                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_10940
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_10940
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_10940
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_10940
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_10940
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_10940
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase
Other DBs
NCBI-ProteinID: QQM39930
UniProt: A0A7T7I2N5
LinkDB
Position
2574042..2574791
AA seq 249 aa
MTSQATMNGTVALVTGGSRGIGAATAVRLAREGADVALTYVRDKEAACDVVDRIRALGRR
ALALRADSADAEEAAGAVERAVAGLGRLDVLVNNAGVGLLGPLDSLSLADVDRVLAVNVR
GVFLASQAAASRMERGGRIITIGTCMTQRVPGPGGTLYATGKSALVGLTKALARELGERG
ITANIVHPGPIDTDMNPADGPYAGGQAAMTAVGRFGTVEEVASAVAYLAGAEASYVTGAE
FSVDGGHAA
NT seq 750 nt   +upstreamnt  +downstreamnt
atgacctcacaagcaaccatgaacggaacagtggccctggtgaccggcggcagccgcggg
atcggcgccgcgaccgccgtgcggctcgcccgggagggtgcggatgtcgccctgacctat
gtacgcgacaaggaggccgcctgcgacgtcgtggaccggatccgggcgctggggcggcgg
gcgctcgccctccgcgcggactccgccgacgccgaggaggccgccggtgccgtggagcgc
gcggtggcggggctcgggcgtctcgacgtcctcgtcaacaacgcgggggtcgggctgctc
gggcccctcgacagcctctccctcgcggacgtcgaccgggtcctcgccgtgaacgtgcgc
ggtgtcttcctcgcctcccaggcggcggcctcgcgtatggagcggggcgggcggatcatc
acgatcggtacgtgcatgactcagcgtgtgcctgggcccggtggcacgttgtacgccacc
gggaagtctgcccttgtcgggctgaccaaggcgttggcgcgggagttgggtgagcggggg
atcactgcgaacatcgtgcatcccgggccgatcgatacggatatgaatccggcggatggg
ccgtatgcggggggtcaggcggcgatgaccgcggtggggcggttcgggacggtggaggaa
gtcgcctccgcggtggcgtatctggcgggggcggaggcgtcgtacgtcacgggggcggag
ttctccgtcgacgggggtcacgccgcctga

KEGG   Streptomyces liliifuscus: JEQ17_13685
Entry
JEQ17_13685       CDS       T08169                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_13685
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_13685
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_13685
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_13685
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_13685
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_13685
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C 3HCDH_N GDP_Man_Dehyd
Other DBs
NCBI-ProteinID: QQM40426
UniProt: A0A7T7I3N8
LinkDB
Position
3255011..3255775
AA seq 254 aa
MPVTAYDLTGRTAFVTGAASGIGRASAVLLAEAGATVHCADRDAQGLDETAARIKDTGGT
AHSHPLDVTDRAQLKDAVAACERLDVMAAVAGIMHSSPVLETRDEDLDRVLGVNFKGVLY
ACQEAALAMIASGTRGSIITMASGAVDTGGPGLLCYGAAKAAVVQLTKTLATEMGPHGIR
VNAVAPGWIRTPMTDRHDGEAQARTEGFMARMSPLGRVGEPEDIAHAVLHLASDASSFTT
GQILRPNGGVAMPW
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcccgtcacggcgtacgacctcaccggacgcaccgcattcgtcaccggcgcggcaagc
ggtatcggccgcgccagtgccgtgctgctcgcggaggcgggggccaccgtccactgcgcg
gaccgcgacgcccagggcctggacgaaacagcggcccgcatcaaggacacgggcggtacc
gcacactcgcaccccctcgacgtcaccgaccgcgcccagctcaaggacgcggtcgccgcc
tgtgagcgcctggacgtcatggccgcggtcgccgggatcatgcacagcagtccggtcctg
gagacccgggacgaggacctcgaccgcgtactcggcgtcaacttcaagggtgttctgtac
gcctgccaggaggcggccctcgcgatgatcgcgtcaggtacgcgcggcagcatcatcacg
atggcgtccggagccgtcgacaccggcgggccgggcctgctctgctacggagcggcgaag
gcggccgtcgtccagcttacgaagacgctggcgacggagatgggcccgcacggcatccgc
gtcaacgcggtggcgccgggctggatccgtacgcccatgaccgaccgccacgacggcgag
gcccaggcgcggaccgaggggttcatggcccggatgtcaccactgggccgggtcggcgag
ccggaggacatcgcccacgcggtcctgcacctcgcctccgacgcctcgtcgttcacaacg
ggccagatcctccgccccaacggaggcgtggcaatgccctggtag

KEGG   Streptomyces liliifuscus: JEQ17_20350
Entry
JEQ17_20350       CDS       T08169                                 
Name
(GenBank) SDR family oxidoreductase
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_20350
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_20350
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_20350
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_20350
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_20350
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_20350
SSDB
Motif
Pfam: adh_short_C2 adh_short KR Epimerase Polysacc_synt_2 DUF6054 LytR_C 3-alpha NAD_binding_10
Other DBs
NCBI-ProteinID: QQM41575
UniProt: A0A7T7I5V5
LinkDB
Position
complement(4828019..4828777)
AA seq 252 aa
MSDQQPITPTTDRVAVVTGGSRGIGRETAERLAADGFAVVVNFAGNQAEADKTVAAITEA
GGQALAFRADVADETEVAALFDTAESTYGGVDVVVHAAGVMTLAPLADFDLDALDRMHRT
NIRGTFVVDQQAVRRLREGGAVINFSSSVLALAIPGYSAYAASKGAVEAMTLILAREMRG
RDITVNAVAPGPTATALFLDGKDEETIARMAAQPPLERLGTPEDIAGVVSFLAGPAGRWV
NGQVLRANGGIA
NT seq 759 nt   +upstreamnt  +downstreamnt
atgagcgaccagcagcccatcacccccaccactgaccgcgtcgcggtcgtcaccggcgga
tcccgtgggatcgggcgagagaccgcggagcggctcgccgccgacggattcgcggtcgtc
gtgaacttcgcggggaaccaggccgaggccgacaagaccgtcgcggcgatcaccgaggcg
ggcggacaggcgctcgccttccgggccgacgtggcggacgagaccgaggtggcggcactc
ttcgacaccgcggagtcgacgtacggcggggtcgacgtggtcgtccacgcggccggtgtc
atgacactggccccgctcgccgacttcgacctcgacgccctggaccggatgcaccgcacg
aacatccgcggcacgttcgtcgtcgaccagcaggccgtgcgccggctgcgcgagggcggc
gcggtcatcaacttctccagctccgtgctggccctcgccatccccggctacagcgcgtac
gccgcgagcaagggcgccgtcgaggccatgacgctgatcctggcccgcgagatgcgcggc
cgggacatcacggtgaacgcggtggcccccggcccgaccgccaccgccctgttcctggac
ggcaaggacgaggagaccatcgcgaggatggccgcccagccgccgctggagcgcctcggc
accccggaggacatcgccggggtcgtgtccttcctcgcgggcccggccggccgctgggtc
aacggccaggtgctccgcgccaacggcggcatcgcttaa

KEGG   Streptomyces liliifuscus: JEQ17_24400
Entry
JEQ17_24400       CDS       T08169                                 
Symbol
fabG
Name
(GenBank) 3-oxoacyl-ACP reductase FabG
  KO
K00059  3-oxoacyl-[acyl-carrier protein] reductase [EC:1.1.1.100]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00061  Fatty acid biosynthesis
slf00333  Prodigiosin biosynthesis
slf00780  Biotin metabolism
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
slf01212  Fatty acid metabolism
slf01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    JEQ17_24400 (fabG)
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JEQ17_24400 (fabG)
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_24400 (fabG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:slf01004]
    JEQ17_24400 (fabG)
Enzymes [BR:slf01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.100  3-oxoacyl-[acyl-carrier-protein] reductase
     JEQ17_24400 (fabG)
Lipid biosynthesis proteins [BR:slf01004]
 Fatty acid synthase
  Component type
   JEQ17_24400 (fabG)
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 Epimerase RmlD_sub_bind Polysacc_synt_2
Other DBs
NCBI-ProteinID: QQM42264
UniProt: A0A7T7I749
LinkDB
Position
complement(5692545..5693264)
AA seq 239 aa
MEQATARSVFVTGGNRGIGLATARRFAAAGDRVTVTYRGEEPPPEAAELLAVRCDVTDSQ
QVDRAFKEAEAAHGPVTVLVANAGTTQDRLLVRMTEEDFTSVVDTNLTGAFRVARRAVRG
MLGAGHGRIVLISSTAALHGAAGQTNYAASKAGLVGFARSLTHELGPRDITCNVVAPGLT
ETDMSRALTEEQRGNLLRRTPAGRLARPEEVADAVAFLVGAGYVRGAVLPVDGGAGLGH
NT seq 720 nt   +upstreamnt  +downstreamnt
atggaacaggcaacggcccggtcggtcttcgtgaccggggggaaccgggggatcgggctg
gccacggcccgccgcttcgcggcggcgggggaccgggtcacggtgacgtaccgcggtgag
gagccgccgcccgaggccgcggaactcctggccgtgcgctgcgatgtgacggacagtcaa
caggtggaccgggccttcaaggaggccgaggcggcccacggcccggtcaccgtcctggtc
gccaacgcgggtaccacccaggaccggctgctggtgcggatgaccgaggaggacttcacc
tccgtggtcgacaccaacctcacgggggccttccgggtcgcccggcgggcggtgcgcgga
atgctgggcgcgggacacggacgtatcgtgctgatctcctcgacggcggccctgcacggc
gccgccgggcagaccaactacgcggcgtcgaaagcgggtctggtcggtttcgcccggtcg
ctgacccacgaactcgggccccgggacatcacctgcaacgtggtggcgcccggactgacc
gagacggacatgagccgtgcgctcaccgaggagcagcgcgggaacctgctgcggcggact
ccggcaggccggctcgcccgccccgaggaggtcgccgacgcggtggcgttcctggtcggc
gccgggtatgtgcgcggcgcggtgctcccggtggacgggggtgcggggctggggcactga

DBGET integrated database retrieval system