Streptomyces liliifuscus: JEQ17_02530 Help Entry JEQ17_02530       CDS       T08169                                  Name (GenBank) acyl carrier protein   KO K21790   acyl carrier protein Organism slf  Streptomyces liliifuscus Pathway slf00333   Prodigiosin biosynthesis slf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:slf00001]  09100 Metabolism   09110 Biosynthesis of other secondary metabolites    00333 Prodigiosin biosynthesis     JEQ17_02530 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PqqD Motif Other DBs NCBI-ProteinID:  QQM38457 UniProt:  A0A7T7HZY4 LinkDB All DBs Position 577591..577839 Genome browser AA seq 82 aa AA seqDB search MSVMYGRLVDLLVDRFEVDRAEISADTTFEDLDMDSLFLVELLLVIQSEFGVDVGDDAAS PGDTITAVADLIERLASAEASA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgagcgtgatgtacggcaggctggtcgatcttctggtcgaccgattcgaggtggaccgt gcggagatcagcgccgacaccacgttcgaggatctcgacatggactcgctgttcctcgtg gaactgctcctggtgatccagtccgagttcggtgtggacgtcggcgacgacgccgcgtct cccggggacacgatcacggctgtcgccgacctgatcgagcgcctcgcgtccgccgaggcc tcagcatga

DBGET integrated database retrieval system