KEGG   Streptomyces liliifuscus: JEQ17_02535
Entry
JEQ17_02535       CDS       T08169                                 
Name
(GenBank) acyl carrier protein
  KO
K21781  peptidyl carrier protein
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02535
SSDB
Motif
Pfam: PP-binding
Other DBs
NCBI-ProteinID: QQM38458
UniProt: A0A7T7I081
LinkDB
Position
577936..578196
AA seq 86 aa
MSTQQSIINYIADVWLDGDADGLDAHVPIADLNIIDSAEIFDLVHYLQNDFRITVPLREI
APANFRTVDTIAALVERLQREGDSVR
NT seq 261 nt   +upstreamnt  +downstreamnt
atgagcacccagcagtcgatcatcaactacatcgccgacgtctggctcgacggtgacgcg
gacgggctcgacgcgcacgtccccatcgccgatctcaacatcatcgattcggccgagatc
ttcgacctcgtgcattacctgcagaacgacttccggatcaccgttccgctgcgggagatc
gctcctgccaacttccggacggtggacacgatcgcagcactcgtcgaacggctgcagcga
gagggagacagcgtccgatga

KEGG   Streptomyces liliifuscus: JEQ17_02545
Entry
JEQ17_02545       CDS       T08169                                 
Name
(GenBank) amino acid adenylation domain-containing protein
  KO
K21780  L-proline---[L-prolyl-carrier protein] ligase [EC:6.2.1.53]
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02545
Enzymes [BR:slf01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.53  L-proline---[L-prolyl-carrier protein] ligase
     JEQ17_02545
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-ProteinID: QQM38460
UniProt: A0A7T7HZY9
LinkDB
Position
580102..581754
AA seq 550 aa
MTGTAIPRTPHEADLSLIRLQRPLSQEQAARPALVGAWTITYGRLDAEVTAIASGLLGLG
VAIGDRVAVWMDKQPLYAEAILATLQAGCAYVPLDGGQPPARVESILVDCEPVALFTDRR
HMELLADRELPASLRTIVVSDGADQEPNSALAKADGRPTAPVRPWADFATGAAGHVGLPP
TPERDDLAAILYTSGSTGTPKGVRISYRNLANFIRWARTELTVGPQDVFANHASFNFDLS
TFDLFTALSVGARVWIVADDQARDVTALATGIRDHGVTVWYSVPSVLKLLTVSGALTADT
ARTLRYVLFAGEVFPIGQLRSLAGLLPEGTELYNLYGPTETNVCTYHRVRPADLTRDEPV
PIGTPLPGVRVSVVDGDGRTLEGPEAFGELIVEGDCVTPGYWRRESQSTAAGHGKGRHAT
GDLVSYEGDSIVYRGRKDRMVKLSGYRVELGEIEAAALRHADISSVAVVVDTQGAEPRIA
LYYTLRTGARRPNLIEIKRHCAQHLPRYMLPHSATCLEELPHNANGKTDYHHLSSGPAGA
VRRSQALPGK
NT seq 1653 nt   +upstreamnt  +downstreamnt
atgacgggaacagccataccccggacgccacacgaggccgacctgtcgctgatccggctg
caacggccgctctcccaggagcaggcggcccgtccggccctcgtcggcgcgtggaccatt
acctacggccggctggacgcggaggtcaccgccatcgcctccggtctgctggggctgggt
gtggcgatcggtgaccgcgtggcggtctggatggacaagcagccgctctacgccgaggcg
attctcgcgacgctgcaggccggttgcgcctacgtcccgctcgacggagggcaaccgccc
gcgcgggtggagagcatcctcgtggactgcgaacccgtggcgctgttcaccgaccgccgt
cacatggagctgctggcggaccgcgaactgcccgcttccctgcggacgatcgtcgtgtcc
gacggtgccgaccaggaaccgaacagcgccctggccaaggccgacggcaggccgacggca
cctgtccggccgtgggccgacttcgccaccggtgcggcgggacacgtcgggctcccgccc
acgccggaacgggacgatctcgccgcgatcctctacacctccgggtcgacgggcactccg
aagggcgtgcggatctcctatcggaatctggcgaacttcatccgctgggcccgcaccgag
ctgaccgtgggcccgcaggacgtgttcgccaaccacgcctcgttcaacttcgacctgtcg
accttcgacctgttcactgcactgtcggtgggcgcccgcgtctggatcgtcgccgacgac
caggcccgcgacgtgacggcgctcgccacgggcatccgagatcacggagtcacggtgtgg
tactccgtgccctccgtgctgaaactcctgacggtctcgggagcactcaccgccgacacc
gcgcgcacgctgcggtacgtcctcttcgccggcgaggtcttccccatcgggcaattgcgc
tccctggccggactgctgcccgaagggaccgagctgtacaacctctacggccccaccgag
accaacgtctgcacctaccaccgggtccgcccggcagacctgacgcgtgacgaacccgta
ccgatcggcactccgctacccggtgtccgcgtgtccgtcgtcgacggggacggacgcacg
ctggaggggcccgaggcattcggcgagttgatcgtggagggggactgcgtcactcccggc
tactggcgacgggagtcacaatcgaccgccgccggacacgggaagggccgccacgccacc
ggggacctggtgagctacgagggcgacagcatcgtctaccgcgggcgcaaggaccggatg
gtcaaactctccggctaccgcgtggagttgggcgagatcgaagccgcggcgctgaggcac
gcggacatctcctccgtggccgtcgtggtcgacacacagggcgccgaaccccggatcgcc
ctctactacaccctccgtacgggtgcccgcagaccgaacctcatcgagatcaagcggcac
tgcgcccagcacctgccccggtacatgctgccgcactcggccacctgtctcgaggagctc
ccgcacaacgccaacggcaagaccgactaccaccacctgagcagcgggccggccggtgcc
gtccgacgctcacaggccctgcccggcaagtga

DBGET integrated database retrieval system