KEGG   Streptomyces liliifuscus: JEQ17_02555
Entry
JEQ17_02555       CDS       T08169                                 
Name
(GenBank) thioesterase
  KO
K21791  thioesterase
Organism
slf  Streptomyces liliifuscus
Pathway
slf00333  Prodigiosin biosynthesis
slf01100  Metabolic pathways
slf01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:slf00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    JEQ17_02555
SSDB
Motif
Pfam: Thioesterase Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Abhydrolase_3 Lipase_3
Other DBs
NCBI-ProteinID: QQM46448
UniProt: A0A7T7L4R6
LinkDB
Position
589694..590515
AA seq 273 aa
MPLLRPTPDSGAGTPPLRLICLPYAGGTPSVYRDWSADLGDDVHVVPVLLPGRGLRVKET
PYTAMAPLVSDLADALVERELAHDYALFGHSMGALLAYEVACELRDRGRPEPTHLFVSGS
KAPHLYGDRRDHQLSDAELRQLVRDLGGLGADDTIGGSYLERRLPVLRADLAVCETYRWA
PRRPLRCPMTAFSATHDPIAPAHEMEAWRVHTRGSLLRHHVEGDHFFLNGPSKPHLLRKI
RAELARHLDESSGPGATARDRLPTVKREPSWIY
NT seq 822 nt   +upstreamnt  +downstreamnt
attcccctactgcgcccgaccccggactcgggggcaggcactcccccactgcgtctcatc
tgccttccgtacgccggcggcacgccgtccgtctaccgggactggtcggcggacctgggc
gacgacgtacacgtcgtgcccgtcctcctgcccggccggggactgcgcgtcaaggaaacg
ccgtacacggccatggcccctctggtgtccgacctcgcggacgccctcgtcgagcgcgaa
ctcgcccatgactacgccctgttcggccacagcatgggagccctgctcgcctacgaggtc
gcctgcgagctgcgcgaccgcggccggcccgagccgacgcacctgttcgtgtcgggaagc
aaggctccgcatctgtacggcgatcgccgggatcaccagctctccgacgccgagctgcgg
cagctggtgcgcgatctcgggggcctgggtgccgacgacaccatcggcggctcgtacctc
gaacggcgtctgccggtgctccgcgccgacctcgccgtctgcgagacctaccgatgggcc
ccgcgccgccccctgcgctgcccgatgaccgcgttctccgccacccacgatccgatcgcg
cccgcgcacgagatggaggcgtggcgcgtccacacccgagggtcgctcctgcgccaccac
gtggagggtgaccacttcttcctcaacggcccttcgaagccgcacctcctgcgcaagatc
cgtgccgaactcgcccgccacctcgacgagtcgagcggcccgggcgcgacggcgcgagac
cgactgcccactgtgaagagggaaccctcatggatctactga

DBGET integrated database retrieval system