KEGG   Solanum lycopersicum (tomato): 101249864
Entry
101249864         CDS       T02665                                 
Name
(RefSeq) (-)-camphene/tricyclene synthase, chloroplastic-like isoform X2
  KO
K21925  (-)-camphene/tricyclene/(4S)-limonene/myrcene synthase [EC:4.2.3.117 4.2.3.105 4.2.3.16 4.2.3.15]
Organism
sly  Solanum lycopersicum (tomato)
Pathway
sly00902  Monoterpenoid biosynthesis
sly01100  Metabolic pathways
sly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sly00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00902 Monoterpenoid biosynthesis
    101249864
Enzymes [BR:sly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.15  myrcene synthase
     101249864
    4.2.3.16  (4S)-limonene synthase
     101249864
    4.2.3.105  tricyclene synthase
     101249864
    4.2.3.117  (-)-camphene synthase
     101249864
SSDB
Motif
Pfam: Terpene_synth_C Terpene_syn_C_2 Terpene_synth RAP
Other DBs
NCBI-GeneID: 101249864
NCBI-ProteinID: XP_004230563
LinkDB
Position
1:93770693..93780814
AA seq 591 aa
MVSILSNIRMIMVTYKRPSLFTSLRRHAANNIIITKHSHPISATRRSGNYKPTLWDFQFI
ESLHNPYAGDKYMKRLNELKKEVKKMMMTVEGSQDEELEKLELIDNLERLGVSYHFKDEI
MQILKSIHEQKITSTDNSLYSTALKFRLLRQHGFHISQDILNDFKDDQGNFKQSHCEDTK
GLLQLYEASFLSTESETLESANTFATSHLKDYLHNLKGDDQENWRIELVRHALELPLRCK
MLRVETRWYIDIYEKIPNANPLLPELAKLDFNILQATHQQDLKNLSRWWNKSLLAEKLPF
TRDRIVESLLWIAGMMFEPQKNDYCRTMLTKVLAMVTVIDDIYDVYGTLDELEIFTDAVQ
RWNVKAVDQLPDYMKICYLALFNTTTEIVYEVLKEQGINVVIYLTKSWSDLCKSYLREAR
WYHSGYKPSLEEYMENGWITIGAPVVLVHTLFLVTNPITKEALESLTSYPDIIQCSATII
RLTDDLGTSSDEMERGDVPKSIQCYMNEKGVSEEDARKHINLLIKETWKLMNTALQKENS
LFSETFIACAVNGARTSHTIYQHGDGYGIQNLHTKNRIRQLFFEPITISIP
NT seq 1776 nt   +upstreamnt  +downstreamnt
atggtttcaatattaagtaacataaggatgattatggtcacctacaagagaccatcatta
tttacctcactccgtcgtcacgctgctaataacattattattactaagcactcacatcct
atttccgccacaaggcgttcagggaattacaagcctaccctatgggattttcaatttatt
gaatccctacacaatccttatgcgggagataagtatatgaagcgtttaaacgaactaaag
aaagaagtgaagaagatgatgatgacggtggagggatcacaggatgaagagttagaaaag
ttggagttgattgataatttagagaggcttggagtgagttaccactttaaagatgaaatt
atgcaaatattgaagagtatacatgaacaaaaaattactagtacagataattcgttatac
tctacagccttgaagtttaggctcctcagacaacatggttttcatatctctcaagatata
ttgaacgatttcaaggatgatcagggtaacttcaagcaaagtcattgtgaagatacaaaa
ggattattacaattatatgaagcttcatttctctctacagaatctgaaaccttggagtcc
gccaatacatttgcaacgtcacatctaaaggattatttgcacaatttaaagggtgatgat
caagagaattggagaatagaactagtgcgtcatgccctagaacttcctttgcgttgcaag
atgttgagagttgagacaagatggtacattgacatttatgagaaaatcccaaatgctaat
cctcttctgccggagcttgctaaattggatttcaacattctgcaagcaacacatcaacaa
gatttaaaaaatctgtcaaggtggtggaacaagtcattgcttgcagaaaaattgccattt
acaagggatagaattgtggagtctttattatggatcgcaggcatgatgtttgaacctcaa
aagaacgattactgccgaacaatgttgacaaaggtccttgctatggttacagtaatagat
gacatttatgatgtttatggcactcttgatgaattggaaatcttcactgatgctgttcaa
agatggaatgtaaaagcagtggatcaacttccagattatatgaaaatatgttaccttgca
ctcttcaacactaccactgaaattgtgtacgaagttctcaaagagcaagggatcaacgtt
gttatctaccttacgaaatcatggtcagatttgtgtaaatcgtacttacgagaagcaaga
tggtaccacagtggatataaaccaagtcttgaagaatacatggaaaatggatggattaca
attggagcaccagtggtattagtacatacattgttccttgtcacaaatccaattaccaaa
gaggccttggaatccttaaccagttatcctgacattattcaatgctctgctactattatt
cgtctcacagatgatttggggacatcctcggatgaaatggaaagaggtgacgttcccaag
tcaattcagtgttacatgaatgagaagggtgtttcagaagaagatgcaagaaaacacatc
aatttgttgataaaggagacatggaaactgatgaacactgctcttcaaaaggagaattcc
ttattttctgaaacattcattgcatgtgcagtaaatggtgcaagaactagtcacacaatt
taccagcatggagatggctatgggattcaaaatcttcacacaaaaaatcgtattcgtcaa
ttatttttcgagcccattacaatttcaattccataa

DBGET integrated database retrieval system