Solanum lycopersicum (tomato): 544095 Help Entry 544095            CDS       T02665                                  Symbol NDK Name (RefSeq) nucleoside diphosphate kinase   KO K00940   nucleoside-diphosphate kinase [EC:2.7.4.6] Organism sly  Solanum lycopersicum (tomato) Pathway sly00230   Purine metabolism sly00240   Pyrimidine metabolism sly01100   Metabolic pathways sly01110   Biosynthesis of secondary metabolites sly01232   Nucleotide metabolism sly01240   Biosynthesis of cofactors sly04016   MAPK signaling pathway - plant Module sly_M00049   Adenine ribonucleotide biosynthesis, IMP => ADP,ATP sly_M00050   Guanine ribonucleotide biosynthesis, IMP => GDP,GTP sly_M00052   Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP sly_M00053   Deoxyribonucleotide biosynthesis, ADP/GDP/CDP/UDP => dATP/dGTP/dCTP/dUTP sly_M00938   Pyrimidine deoxyribonucleotide biosynthesis, UDP => dTTP Brite KEGG Orthology (KO) [BR:sly00001]  09100 Metabolism   09104 Nucleotide metabolism    00230 Purine metabolism     544095 (NDK)    00240 Pyrimidine metabolism     544095 (NDK)  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     544095 (NDK)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:sly04131]     544095 (NDK) Enzymes [BR:sly01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.4  Phosphotransferases with a phosphate group as acceptor     2.7.4.6  nucleoside-diphosphate kinase      544095 (NDK) Membrane trafficking [BR:sly04131]  Exocytosis   Calcium ion-dependent exocytosis    Kinases and associated proteins     544095 (NDK) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NDK Motif Other DBs NCBI-GeneID:  544095 NCBI-ProteinID:  NP_001234174 UniProt:  A0A3Q7F3S0 LinkDB All DBs Position 1:79454266..79455773 Genome browser AA seq 148 aa AA seqDB search MEQTFIMIKPDGVQRGLVGEIISRFEKKGFSLKGLKLITVDRAFAEKHYADLSAKPFFNG LVEYIVSGPVVAMVWEGKGVVATGRKIIGATNPLESAAGTIRGDFAIDIGRNVIHGSDAV ESARKEIALWFPEGIAEWQSSLHSWIYE NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggagcagactttcatcatgatcaagcctgatggtgtccaacgtggcctggttggtgag attatcagcagatttgagaagaaaggattctctttgaaaggcttgaagctcattactgtg gaccgtgcctttgctgagaagcattacgcagacttgtcggcgaagcctttctttaatggg cttgttgagtatattgtttctggacctgttgttgctatggtctgggagggtaagggtgta gttgccactggcaggaagatcattggagcaaccaaccccttggagtctgctgctggaact atccgtggtgattttgctattgacattggcaggaatgtcatccatggaagtgatgctgtt gagagtgctaggaaggagatcgctctttggttccctgaaggaatcgcggagtggcagagc agccttcactcttggatctatgaatag

DBGET integrated database retrieval system