KEGG   Streptomyces avermitilis: SAVERM_938
Entry
SAVERM_938        CDS       T00126                                 
Symbol
aveA1
Name
(GenBank) type I polyketide synthase AVES 1
  KO
K14371  avermectin polyketide synthase AveA1
Organism
sma  Streptomyces avermitilis
Pathway
sma00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sma01052  Type I polyketide structures
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00777  Avermectin biosynthesis, 2-methylbutanoyl-CoA/isobutyryl-CoA => 6,8a-Seco-6,8a-deoxy-5-oxoavermectin 1a/1b aglycone => avermectin A1a/B1a/A1b/B1b
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SAVERM_938 (aveA1)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SAVERM_938 (aveA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_938 (aveA1)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Avermectin PKS
     SAVERM_938 (aveA1)
SSDB
Motif
Pfam: Acyl_transf_1 ketoacyl-synt KR Ketoacyl-synt_C PS-DH PP-binding KAsynt_C_assoc adh_short Thiolase_N PKS_DE adh_short_C2 Epimerase GDP_Man_Dehyd Polysacc_synt_2 Erythro-docking ACP_syn_III
Other DBs
NCBI-ProteinID: BAC68648
NITE: SAV0938
UniProt: Q79ZN1
Structure
LinkDB
Position
1137817..1149735
AA seq 3972 aa
MQRMDGGEEPRPAAGEVLGVADEADGGVVFVFPGQGPQWPGMGRELLDASDVFRESVRAC
EAAFAPYVDWSVEQVLRDSPDAPGLDRVDVVQPTLFAVMISLAALWRSQGVEPCAVLGHS
LGEIAAAHVSGGLSLADAARVVTLWSQAQTTLAGTGALVSVAATPDELLPRIAPWTEDNP
ARLAVAAVNGPRSTVVSGAREAVADLVADLTAAQVRTRMIPVDVPAHSPLMYAIEERVVS
GLLPITPRPSRIPFHSSVTGGRLDTRELDAAYWYRNMSSTVRFEPAARLLLQQGPKTFVE
MSPHPVLTMGLQELAPDLGDTTGTADTVIMGTLRRGQGTLDHFLTSLAQLRGHGETSATT
VLSARLTALSPTQQQSLLLDLVRAHTMAVLNDDGNERTASDAGPSASFAHLGFDSVMGVE
LRNRLSKATGLRLPVTLIFDHTTPAAVAARLRTAALGHLDEDTAPVPDSPSGHGGTAAAD
DPIAIIGMACRFPGGVRSPKDLWELAASGGDAIGPFPTDRGWPTEQRHAQDPTQPGTFYP
QGGGFLHDAAHFDAGFFGISPREALAMDPQQRLLLETSWEAFERAGIDPLSVRGSRTGVF
AGALSFDYGPRMDTASSEGAADVEGHILTGTTGSVLSGRIAYSFGLEGPAITVDTGCSAS
LVTLHLACQSLRSGECTLALAGGVSVMSTLGMFIEFSRQRGLSVDGRCKAYSAAADGTGW
GEGVGMLLVERLSDAVRLGHRVLAVVRGSAVNQDGASNGLTAPNGPAQERVIRQALANAG
LSVADVDVVEGHGTGTTLGDPIEAQALLATYGQRAGDRPLWLGSLKSNIGHTMAAAGVGG
VIKMVMALREGVLPRTLHVDKPSPQVDWSAGAVRLLTEAVPWPGDAAGRLRRAGVSSFGI
GGTNAHVILEEAPAAGGCVAGGGVLEGAPGLAISVAESVAAPVAVSAPVAESVPVPVPVP
VPVPVSARSEAGLRAQAEALRQYVAVRPDVSLADVGAGLACGRAVLEHRAVVLAADREEL
VQGLGALAAGEPDRRVTTGHAPGGDRGGVVFVFPGQGGQWAGMGVRLLASSPVFARRMQA
CEEALAPWVDWSVVDILRRDAGDAVWERADVVQPVLFSVMVSLAALWRSYGIEPDAVLGH
SQGEIAAAHVCGALSLKDAAKTVALRSRALAAVRGRGGMASVPLPAQEVEQLIGERWAGR
LWVAAVNGPRSTAVSGDAEAVDEVLAYCAGTGVRARRIPVDYASHCPHVQPLREELLELL
GDISPQPSGVPFFSTVEGTWLDTTTLDAAYWYRNLHQPVRFSDAVQALADDGHRVFVEVS
PHPTLVPAIEDTTEDTAEDVTAIGSLRRGDNDTRRFLTALAHTHTTGIGTPTTWHHHYTH
HHTHPHPHTHLDLPTYPFQHQHYWLESSQPGAGSGSGAGAGSGAGSGRAGTAGGTAEVES
RFWDAVARQDLETVATTLAVPPSAGLDTVVPALSAWHRHQHDQARINTWTYQETWKPLTL
PTTHQPHQTWLIAIPETQTHHPHITNILTNLHHHGITPIPLTLNHTHTNPQHLHHTLHHT
RQQAQNHTTGAITGLLSLLALDETPHPHHPHTPTGTLLNLTLTQTHTQTHPPTPLWYATT
NATTTHPNDPLTHPTQAQTWGLARTTLLEHPTHTAGIIDLPTTPTPHTLQHLTQTLTQPH
HQTQLAIRTTGTHTRRLTPTTLTPTHQPPTPTPHGTTLITGGTGALATHLTHHLTTHQPT
QHLLLTSRTGPHTPHAQHLTTQLQQKGIHLTITTCDTSNPDQLQQLLNTIPPQHPLTTVI
HTAGILDDATLTNLTPTQLNNVLRAKAHSAHLLHQLTQHTPLTAFVLYSSAAATFGAPGQ
ANYAAANAYLDALAHHRHTHHLPATSIAWGTWQGNGLADSDKARAYLDRRGFRPMSPELA
TAAVTQAIADTERPYVVIADIDWSKIEHTSQTSDLVSAAREREPAVQRPTPPAELHKTLA
HQTSADQRAALLELVRDHVAAVLRHADPKAIAPDQSFRALGFDSLTAVEFRNLLIKATGL
RLPVSLVFDHPTPAKLAVHLQNQLRGTAAESAPSAAAVTAEASVTEPIAIVGMACRFPGG
VTSADDFWDLISSEQDAIGGFPTDRGWDLDTLYDPDPDHPGTCYTRNGGFLYDAGHFDAE
FFGISPREALAMDPQQRLLLETAWETIEHAGINPHTLHGTPTGVFTGTNGQDYALRVHNA
GQSTDGFALTGTAGSVISGRISYTFGFEGPAVSVDTACSSSLVALHLACQALRAGECSMA
LAGGVTVMSSPGAFVEFSRQRGLAADGHCKAFSAAADGTGWGEGVGMLLVERLSDAHRNG
HRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALANAGLSAGDVDAVEAHGTGTTLG
DPIEAQALLATYGQDRAGEGPLWLGSVKSNVGHTQAAAGVAGVIKMVMALRHGLLPRTLH
VDEPSPHVDWSAGAVQLLTETVPWPGGEGRLRRAGVSSFGVSGTNAHVILEEAPADDVPG
GPPAGEGDAGSDDEAAAGSPGVWPWLVSAKSQPALRAQAQALHAHLTDHPGLDLADVGYT
LAHARAVFDHRATLIAADRDTFLQALQALAAGEPHPAVIHSSAPGGTGTGEAAGKTAFIC
SGQGTQRPGMAHGLYHTHPVFAAALNDICTHLDPHLDHPLLPLLTQNDNDNEDAAALLQQ
TRYAQPALFAFQVALHRLLTDGYHITPHYYAGHSLGEITAAHLAGILTLTDATTLITQRA
TLMQTMPPGTMTTLHTTPHHITHHLTAHENDLAIAAINTPTSLVISGTPHTVQHITTLCQ
QQGIKTKTLPTNHAFHSPHTNPILNQLHQHTQTLTYHPPHTPLITANTPPDQLLTPHYWT
QQARNTVDYATTTQTLHQHGVTTYIELGPDNTLTTLTHHNLPNPPTTTLTLTHPHHHPQT
HLLTNLAKTTTTWHPHHYTHHDNQPHTHTHLDLPTYPFQHHHYWLESTQPGAGNVSAAGL
DPTEHPLLGATLELATDGGALLAGRLSLRSHPWLADHAVGGTVLLSGATFLELALHAGTY
VGCDRVDELTLHAPLVVPVDGGVSVQVGVAAADGEGRRLVSVYARGGSACGGGGASGGVW
TCHASGVLVEAAAGGVVVDGLAGVWPPRGAVAVDVDGVRDRLAGAGCVLGPVFSGLRAVW
RDGGDLLAEVCLPEEAWGDAAGFGLHPALLDGVVQPLSVLLPGGTGFGEGAGFGEGVRVP
AVWGGVSLHRAGVTGVRVRVSAVGRGGGREAVSVVVGDEAGVPVASVDRLELRPVDMGQL
RAVSVSAGRRGSLYAVQWAEVGPVPVCGQAWAWHEDVGESGGGPVPGVVVLRCPDAGAGG
GGGGGGGGGVGEVVGGVLGVVQGWLGLERFAGSRLVVVTRGAVVAGPEDGPVDVVGASVW
GLVRSAQAEHPDRFVLLDLDTDTGTDLDTGAGAGWGVDGGRVAAVVACGEPQLAVRGERL
LAARLKRLESSGDVPAQRSGDTRARRSDVPAQRSGGVPARRSVDVSGREVLPWLSGGSVL
VTGGTGVLGAAVARHLAGVCGVRDLLLVSRRGPDAPGAEGLRAELAALGAEVRIVACDVG
ERREVVRLLEGVPAGCPLTGVVHAAGVLDDATIASLTPERLGTVFAAKVDAALLLDELTR
GMELSAFVLFSSAAGILGSAGQGNYAAANAALDALAYRRRAAGLPGVSLAWGLWEEASGM
TGHLAGTDHRRIIRSGLHPMSTPDALALFDAALALDRPVLLPADLRPAPPLPPLLQDLLP
ATRRRTTRTTTTGGADNGAQLHARLAGQTHEQQHTTLLALVRSHIATVLGHTTPDTIPPD
RAFRDLGFDSLTAVELRNRLSRTTGLRLPTTLAFDHPNPTTLTHHLHTQLQPQPDNAVAP
VLAELDKLESALSALDKTDSASERVTLRLKSLMLRWNAPQHPTAESADDDEKFTSATEAE
IFKFIDNDLGLS
NT seq 11919 nt   +upstreamnt  +downstreamnt
gtgcagaggatggacggcggggaagaaccccgccctgcggcaggggaggtcctcggagtg
gccgacgaggcggacggcggcgtcgtcttcgtttttcccgggcagggcccgcaatggccg
ggcatgggaagggaacttctcgacgcttccgacgtcttccgggagagcgtccgcgcctgc
gaagccgcgttcgcgccctacgtcgactggtcggtggagcaggtgttgcgggactcgccg
gacgctcccgggctggaccgggtggacgtcgtccagccgaccctgttcgccgtcatgatc
tccctggccgccctctggcgctcgcaaggggtcgagccgtgcgcggtgctgggacacagc
ctgggcgagatcgcggcagcccacgtctcgggaggcctgtccctggccgacgccgcacgc
gtggtgacgctttggagccaggcacagaccacccttgccgggaccggcgcgctcgtctcc
gtcgccgccacgccggatgagctcctgccccgaatcgctccgtggaccgaggacaacccg
gcgcggctcgccgtcgcagccgtcaacggaccccggagcacagtcgtttccggtgcccgc
gaggccgtcgcggacctggtggccgacctcaccgccgcgcaggtgcgcacgcgcatgatc
ccggtggacgttcccgcccactcccccctgatgtacgccatcgaggaacgggtcgtcagc
ggcctgctgcccatcaccccacgcccctcccgcatccccttccactcctcggtgaccggc
ggccgcctcgacacccgcgagctagacgcggcgtactggtaccgcaacatgtcgagcacg
gtccggttcgagcccgccgcccggctgcttctgcagcaggggcccaagacgttcgtcgag
atgagcccgcacccggtgctgaccatgggcctccaggagctcgccccggacctgggcgac
accaccggcaccgccgacaccgtgatcatgggcacgctgcgccgcggccagggcaccctg
gaccacttcctgacgtctctcgcccaactacgggggcatggtgagacgtcggcgaccacc
gtcctctcggcacgcctgaccgcgctgtcccccacgcagcagcagtcgctgctcctggac
ctggtgcgcgcccacaccatggcggtgctgaacgacgacggaaacgagcgcaccgcgtcg
gatgccggcccatcggcgagtttcgcccacctcggcttcgactccgtcatgggtgtcgaa
ctgcgcaaccgcctcagcaaggccacgggcctgcggttgcccgtgacgctcatcttcgac
cacaccacgccggccgcggtcgccgcgcgccttcggaccgcggcgctcggccacctcgac
gaggacaccgcgcccgtaccggactcacccagcggccacggaggcacggcagcggcggac
gacccgatcgccatcatcggcatggcatgccgtttcccgggcggagtccggtccccgaag
gacctgtgggagctggccgcctcgggcggagacgccatcgggccgttccccaccgaccgc
ggatggcccacggaacagcgtcacgcccaggaccccacgcagcccggcacgttctatccg
cagggaggcgggttccttcacgacgcggcgcacttcgacgccggcttcttcggaatcagt
ccacgtgaggcactggcgatggatccgcagcagcggctgctgctggagacgtcctgggag
gcgttcgagcgggcgggaatcgatccgctgtcggtacgcgggtcccgtacgggcgtcttc
gcgggcgccctctccttcgactacggcccgcgtatggacaccgcgtcgtcggagggcgcc
gcggacgtggagggccacatcctcaccggtaccacgggcagcgtcctgtcgggccgtatc
gcctacagcttcgggctggaagggccggcgatcaccgtggacacggggtgctcggcatcg
ctcgtgacgctgcatctggcgtgccagtcgctgcggtcgggtgagtgcacgctcgcgctg
gccggcggcgtctcggtcatgtccaccctcggcatgttcatcgagttctcccggcagcgc
gggctgtcggtggacggcaggtgcaaggcgtactcggctgcagccgacggcaccggctgg
ggcgagggcgtcgggatgctgttggtggagcggttgtcggatgcggtgcggctggggcat
cgggtgctggcggtggtacgcggcagtgcggtcaaccaggacggtgcgtcgaatgggctg
acggcgccgaacggtccggctcaggagcgggtgatccggcaggcgttggcgaacgcgggg
ttgtccgtggcggatgtggatgtggtggaggggcacgggacgggcacgacgctgggtgat
ccgatcgaggcacaggcgttgctcgccacgtacgggcagcgggccggtgacaggccgctg
tggctggggtctctgaagtccaacatcgggcacaccatggctgccgcgggtgtgggtggg
gtcatcaagatggtgatggcgttgcgggagggggtgttgccgcggacgttgcatgtggat
aagccgtcgccgcaggtggactggtccgcgggggcggtgcggctgctgacggaggcggtg
ccgtggccgggggacgcggcagggcggttgcggcgggcgggagtgtcgtcgttcgggatc
ggcggcacgaatgcgcatgtgattttggaggaggcgccggcggcggggggctgtgttgcc
gggggtggggtgttggagggtgctccgggtcttgccatttcggtggctgagtcggtggcc
gctccagtggctgtgtctgcgccggtggctgagtcggtgccggtgccggtgccggtgccg
gttcctgtgccggtgtcggctaggtctgaggctgggttgcgggcgcaggcggaggcgttg
cgtcagtacgtggcagtccggccggacgtttcgcttgccgatgtgggtgcgggtctggcc
tgtgggcgggctgtgctggagcatcgtgcggtcgtcctggccgcggaccgtgaggagctg
gtgcaagggttgggggcgctggcggcgggtgagccggatcggcgggtgaccacgggtcat
gcgccgggtggtgaccggggcggtgtcgtcttcgtgtttcccggacagggtgggcagtgg
gccgggatgggtgtgcgtctgctcgcctcctctccggtgttcgcccggcggatgcaggcg
tgcgaggaggctctggcgccgtgggtggactggtctgtggtggacatcctgcgccgggac
gcgggggatgcggtgtgggagcgggccgatgtggtccagcctgtgctgttcagcgtcatg
gtgtctttggctgctctgtggcgttcctacggtatcgaacccgacgcggtccttggccat
tcccagggcgagatcgcggccgcgcatgtgtgtggggcgctgagcctgaaggacgcggcg
aagactgttgcgctgcgcagccgggcgctggccgctgtgcggggccggggcggcatggcc
tcagtgccgctgcctgcccaggaggtggagcagctcattggtgagcggtgggcggggcgg
ttgtgggtggcggcggtcaacggcccccgctccaccgccgtctcgggggatgccgaggcg
gtggacgaggtgctggcgtactgtgccggcaccggggtgcgggcccggcggatcccggtc
gactatgcctcgcactgcccccatgtgcagcccctgcgggaggagttgctggagctgctg
ggggacatcagcccgcagccgtccggcgtgccgttcttctccacggtggagggcacctgg
ctggacaccacaaccctggacgccgcctactggtaccgcaacctgcaccagccggtccgt
ttcagcgatgccgtccaggccctggcggatgacggacaccgcgtcttcgtcgaagtcagc
ccccaccccaccctcgtccccgccatcgaagacaccaccgaagacaccgccgaagacgtc
accgcgatcggcagcctccgccgcggcgacaacgacacccgccgcttcctcaccgccctc
gcccacacccataccaccggcatcggcacacccaccacctggcaccaccactacacccac
caccacacccacccccacccccacacgcacctcgacctgcccacctaccccttccaacac
cagcactactggctcgagagctcacagccgggtgccggatccggttcgggtgccggtgcc
ggttcgggtgccggttccgggcgggcagggactgcgggcgggacggcagaggtggagtcg
cggttctgggacgcggtggcccgccaggacctggaaacggtcgcgaccacactcgccgtg
cccccctccgccggcctggacacggtggtgcccgcactctccgcctggcaccgccaccaa
cacgaccaagcccgcatcaacacctggacctaccaggaaacctggaaacccctcaccctc
cccaccacccaccaaccccaccaaacctggctcatcgccatccccgaaacccagacccac
cacccccacatcaccaacatcctcaccaacctccaccaccacggcatcacccccatcccc
ctcaccctcaaccacacccacaccaacccccaacacctccaccacaccctccaccacacc
cgacaacaagcccaaaaccacaccaccggagccatcaccggcctgctctccctcctcgcc
ctcgacgaaacaccccacccccaccacccccacacacccaccggcaccctcctcaacctc
accctcacccaaacccacacccaaacccacccaccaacccccctctggtacgccaccacc
aacgccaccaccacccaccccaacgaccccctcacacaccccacccaagcccaaacctgg
ggactcgcccgcaccaccctcctcgaacaccccacccacaccgccggaatcatcgacctc
cccaccacccccaccccccacaccctccagcacctcacccaaaccctcacccaaccccac
caccaaacccaactcgccatccgcaccaccggcacccacacccgccgcctcacccccacc
accctcacccccacacaccaaccacccacccccaccccccacggaaccaccctcatcacc
ggcggaaccggcgccctcgccacccacctcacccaccacctcaccacccaccaacccacc
caacacctcctcctcaccagccgaaccggcccccacaccccccacgcacaacacctcacc
acccaactccaacaaaaaggcatccacctcaccatcaccacctgcgacaccagcaaccca
gaccaactccaacaactcctcaacaccatccccccacaacaccccctcaccaccgtcatc
cacaccgcaggcatcctcgacgacgccaccctcaccaacctcacccccacccaactcaac
aacgtcctccgcgccaaagcccacagcgcccacctcctccaccaactcacccaacacacc
cccctcaccgccttcgtcctctactcctccgccgccgccaccttcggcgcacccggccaa
gccaactacgccgcagccaacgcctacctcgacgccctcgcccaccaccgccacacccac
cacctccccgccaccagcatcgcctggggcacctggcaaggaaacggactcgctgattcg
gacaaggcccgcgcatatctcgaccgccgcgggtttcgacccatgtcacccgagttggcc
acggcagcggtcacgcaggcgatcgcggacaccgaacggccgtatgtcgtcatcgccgac
atcgactggagcaagatcgaacacacctctcagaccagcgacctggtgagcgcggcccgg
gaaagggagccagctgtccagcgccccactccaccggcggagttgcacaaaacgctggcc
catcagacgtcggccgaccaacgggccgcattgctcgagctcgtacgagaccatgtggcg
gcagtgctccggcacgcggacccgaaagccatcgcgcccgaccagtcgttccgtgcactc
ggcttcgattcactcacggccgtcgagttccgaaacctgctgatcaaggcaacaggactc
cgccttcctgtctcgctggtcttcgaccacccgacccctgccaaactcgccgtacacctg
cagaaccaactgcggggcacagcagcggagtcggctccttcagcggcagccgttaccgcc
gaggcttctgtcaccgagccgatcgccatcgttggcatggcctgtcgtttccccggcgga
gtgacctcggcggacgacttctgggatctgatctcctccgagcaggacgcgatcggcgga
ttccccaccgaccgcggctgggacctggacacgctctacgaccccgaccccgaccacccc
ggcacctgctacacccgaaacggcggattcctctacgacgcaggccacttcgacgccgaa
ttcttcggcatcagcccccgcgaagccctcgccatggacccccagcaacgactcctcctc
gaaaccgcctgggaaaccatcgaacacgccggcatcaacccccacaccctccacggcacc
cccaccggagtcttcaccggcaccaacggacaggactacgcacttcgcgtgcacaacgcg
ggccagtcaaccgatggtttcgcactgaccggaaccgccggcagcgtcatctccggtcgt
atctcgtacacgtttggttttgagggtcctgcggtgtcggtggacacggcttgttcctcg
tcgttggtggctttgcatctggcctgtcaggcgttgcgtgcgggtgagtgctcgatggcg
cttgccgggggtgtgacggtgatgtcgtctccgggtgccttcgtggagttttcgcggcag
cggggtctggccgcggacgggcattgcaaggcgttctcggcggcggcggacgggaccggc
tggggtgagggtgtggggatgctgctggtggagcggctctccgacgcccatcgcaacggt
caccgtgtcctggccgtggtgcgtggcagtgcggtcaaccaggacggtgcgagcaacggt
ctgaccgcgcccaacgggccgtcccagcagcgtgtcatccgccaggccctcgccaacgcc
ggcttgtcggccggtgatgtcgacgcggtggaggcccacggcaccggcaccactttgggc
gacccgatcgaggcccaggccctcctcgcgacctacggacaggaccgtgccggcgagggg
ccgctgtggctgggctcggtcaagtccaatgtcggtcacacacaggctgccgcgggcgtc
gccggggtgatcaagatggtgatggcgctgcggcatggtctgctgccgcggacgttgcat
gtggatgagccgtcgccgcatgtggactggtccgcgggtgcggtgcagctgctgacggag
acggtgccctggcccggcggggaggggcggctacggcgggcaggagtgtcatcattcggc
gtcagcggcaccaacgcccacgtcatcctcgaagaagcacccgccgacgacgttccgggg
ggaccacccgccggcgagggtgacgcgggcagcgacgatgaggctgctgccggcagtcct
ggggtgtggccgtggctggtgtcggccaagtcgcagccggccctgcgcgcccaggcccag
gccctgcacgcccacctcaccgaccaccccggcctcgacctcgcggatgtcggatacacc
ctcgcccacgcccgcgccgtgttcgaccaccgcgccaccctcatcgccgcggaccgcgac
acgttcctgcaagcactccaggcactcgccgcaggcgagccccaccccgccgtcatccac
agcagcgccccgggcgggaccgggaccggggaggccgcaggaaagaccgcattcatctgc
tccggacagggcacccaacgccccggcatggcccacggcctctaccacacccaccccgtc
ttcgccgccgcactcaacgacatctgcacccacctcgacccccacctcgaccaccccctc
ctccccctcctcacccaaaacgacaacgacaacgaggacgcggccgcactgctccagcag
acccgctacgcccagcccgccctcttcgccttccaggtcgccctccaccgcctcctcacc
gacggctaccacatcaccccccactactacgccggacactccctcggcgaaatcaccgcc
gcccacctcgccggcatcctcaccctcaccgacgccaccaccctcatcacccaacgcgcc
accctcatgcaaaccatgccccccggcaccatgaccaccctccacaccaccccccaccac
atcacccaccacctcaccgcccacgaaaacgacctcgccatcgccgccatcaacaccccc
acctccctcgtcatcagcggcaccccccacaccgtccaacacatcaccaccctctgccaa
caacaaggcatcaaaaccaaaaccctccccaccaaccacgccttccactccccccacacc
aaccccatcctcaaccaactccaccagcacacccaaaccctcacctaccacccaccccac
acccccctcatcaccgccaacaccccacccgaccaactcctcaccccccactactggacc
caacaagcccgcaacaccgtcgactacgccaccaccacccaaaccctccaccaacacggc
gtcaccacctacatcgaactcggacccgacaacaccctcaccaccctcacccaccacaac
ctccccaacccccccaccaccaccctcaccctcacccacccccaccaccacccccaaacc
cacctcctcaccaacctcgccaaaaccaccaccacctggcacccccaccactacacccac
cacgacaaccaaccccacacccacacccacctcgacctccccacctaccccttccaacac
caccactactggctcgaaagcacacagcccggtgccggcaacgtgtcagcagccggactc
gaccccaccgaacaccccctactcggcgccacattggaactggcgactgacggtggagcg
cttcttgcagggcgcttgtctttgaggtcgcatccgtggctggctgaccatgccgtcggc
ggcacggtgctgctgtcgggcgccaccttcctcgaactcgcccttcatgcgggcacatac
gtgggctgcgaccgagtggatgagctgacgctgcatgcgccgctggtggttcctgtggat
gggggtgtgagtgtgcaggttggggttgcggctgcggatggggaggggcggcgtttggtg
agtgtgtatgcgcggggtgggagtgcttgtggtgggggtggtgcgtcgggtggggtgtgg
acgtgtcatgcctcgggggtgctggttgaggctgctgctggtggtgtggtggtggatggt
ctggcgggggtgtggccgccgcggggtgcggtggcggtggatgtcgatggtgtccgtgac
cgtttggctggggctggttgtgttttggggccggtgttttcggggctgcgtgcggtgtgg
cgtgatgggggggatttgctggctgaggtgtgtctgccggaggaggcgtggggtgatgcg
gctggttttgggctgcatccggcgttgctggatggtgtggtccagccgttgtcggtgttg
cttccgggtgggacggggtttggggagggggcggggttcggggagggtgttcgggtgccg
gctgtgtggggtggtgtgtcgcttcaccgggcgggtgtgaccggtgtgcgggtgcgtgtg
tcggctgtcgggcggggcggcgggcgtgaggcggtgtcggtcgtggtcggggatgaggcg
ggtgtgccggtggcgtcggtcgatcgtcttgagttgcggcctgtggatatgggtcagttg
cgtgctgtctcggtttcggcggggcggcggggttcgctgtatgcggtgcagtgggctgag
gtgggtcctgtgccggtgtgtgggcaggcgtgggcgtggcacgaggacgtgggtgagagc
ggtggtgggcctgtgccgggggtggtggtgttgcggtgcccggatgccggtgccggtggc
ggtggcggtggcggtggtggcggtggtgtgggtgaggttgttggtggggtgttgggtgtg
gtgcaggggtggctggggctggagcggtttgcgggttcgcggctggtggtggtgacccgg
ggtgcggtggtggccggcccggaggacggcccggtggatgtggtgggtgcgtcggtgtgg
gggctggtgcgttcggcgcaggctgagcatccggaccggtttgtcctcctcgacctcgac
accgacaccggcaccgacctcgacaccggtgctggtgctggttggggcgtggatggtggg
cgtgtggcggcggtggtggcgtgtggtgagccgcagttggcggtgcgtggggagcggttg
ctggccgcacgcctgaaacgacttgagtcatccggtgatgttccagcccagcggtccggt
gacacacgagcccggcggtccgacgtgcctgcccagcgctccggtggcgtgcctgctcgg
cggtcggttgatgtatcgggtcgggaggtgttgccgtggttgtcgggtgggtcggtgttg
gtgacgggtgggacgggtgtgctgggtgcggcggtggcgcggcatctggctggtgtgtgt
ggggtgcgggatctgctgttggtgagccggcgtggtccggatgctccgggtgcggagggt
ctgcgggcggagctggccgcgttgggggcggaggtgcggattgttgcgtgtgatgtgggg
gagcggcgggaggtggtccggctgctggagggtgttcctgccgggtgtccgctgacgggt
gtcgtgcatgcggctggtgtgctggacgatgcgacgatcgcctctctcacgcccgagcgg
ctgggcacggtgttcgcggccaaggtggatgccgctcttttgctggatgagctgacgcgg
ggtatggagctgtcggcgttcgtgctgttctcctcggccgcggggatcctggggtcggcc
gggcagggcaactacgccgcggccaatgccgctctggacgcgctggcgtaccggcggcgg
gcggcgggtctgccgggggtgtcgctggcgtgggggctgtgggaagaggccagcgggatg
accgggcacctggccggcaccgaccaccggcgcatcatccgttccggtctgcatcccatg
tcgaccccggacgcactggccctcttcgatgcggccctggctctggaccggccggtcctg
ctgcccgccgacctgcgtcccgccccgcccctgccgcccctgctgcaggacctcctgccc
gccacccgccgccgcaccacccgcaccaccactaccggtggtgcggacaacggcgcccag
ctgcacgcccggctggccggccagacacacgaacaacagcacaccaccctcctcgccctg
gtccgctcccacatcgccaccgtcctgggccacaccacccccgacaccatcccccccgac
cgcgcgttccgcgacctcggcttcgactccctcaccgccgtcgaactacgcaaccggctc
tcccgcaccaccggactccgcctccccaccaccctcgccttcgaccaccccaaccccacc
accctcacccaccacctccacacacaactccagccacaaccggacaacgctgtcgccccc
gtgttggcggagctcgacaaactcgaatccgccctctccgccctcgacaaaaccgacagc
gccagcgaaagagtcaccctgcggctgaagtcactcatgttgaggtggaacgcaccccag
catccgacagccgaaagcgctgatgacgacgagaagttcacatcggcaacagaggctgag
attttcaaattcattgacaacgacctcggcctgtcctga

DBGET integrated database retrieval system