KEGG   Streptomyces avermitilis: SAVERM_941
Entry
SAVERM_941        CDS       T00126                                 
Symbol
aveE
Name
(GenBank) cytochrome P450 hydroxylase
  KO
K14372  cytochrome P450 hydroxylase [EC:1.14.-.-]
Organism
sma  Streptomyces avermitilis
Pathway
sma00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sma01052  Type I polyketide structures
sma01100  Metabolic pathways
sma01110  Biosynthesis of secondary metabolites
Module
sma_M00777  Avermectin biosynthesis, 2-methylbutanoyl-CoA/isobutyryl-CoA => 6,8a-Seco-6,8a-deoxy-5-oxoavermectin 1a/1b aglycone => avermectin A1a/B1a/A1b/B1b
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SAVERM_941 (aveE)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SAVERM_941 (aveE)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_941 (aveE)
   00199 Cytochrome P450 [BR:sma00199]
    SAVERM_941 (aveE)
Enzymes [BR:sma01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     SAVERM_941 (aveE)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide tailoring proteins
  Oxygenase
   SAVERM_941 (aveE)
Cytochrome P450 [BR:sma00199]
 Cytochrome P450, bacteria type
  CYP171 family
   SAVERM_941 (aveE)
SSDB
Motif
Pfam: p450 Talin_middle
Other DBs
NCBI-ProteinID: BAC68651
NITE: SAV0941
UniProt: Q79ZM8
LinkDB
Position
complement(1169630..1171000)
AA seq 456 aa
MMSQSTSSIPEAPGAWPVVGHVPPLMRQPLEFLRSAADHGDLLKLRLGPKTAYLATHPDL
VRTMLVSSGSGDFTRSKGAQGASRFIGPILVAVSGETHRRQRRRMQPGFHRQRLESYVAT
MAAAAQETADSWSAGQVVDVEQAACDLSLAMITKTLFFSDLGAKAEAALRKTGHDILKVA
RLSALAPTLYEVLPTAGKRSVGRTSATIREAITAYRADGRDHGDLLSTMLRATDAEGASM
TDQEVHDEVMGIAVAGIGGPAAITAWIFHELGQNAEIESRLHAELDTVLGGRLPTHEDLP
RLPYTQNLVKEALRKYPGWVGSRRTVRPVRLGGHDLPADVEVMYSAYAIQRDPRWYPEPE
RLDPGRWETKGSSRGVPKGAWVPFALGTYKCIGDNFALLETAVTVAVVASHWRLHALPGD
EVRPKTKATHVFPNRLRMIAEPRSVVRLEEPAAMGA
NT seq 1371 nt   +upstreamnt  +downstreamnt
gtgatgtcccagtcgacgagcagcattcccgaggcgcccggcgcctggccggtcgtcggc
catgtgccgccgttgatgcggcagcccctggagttccttcgctccgcagcagatcacgga
gacctgctcaagctccgcctcgggccgaaaaccgcctacctcgccacgcacccggacctg
gtgcggaccatgctggtctcctccggatcgggcgatttcacccggagcaagggcgcacag
ggcgcgagccgcttcatcggccccatcctcgtagccgtatcgggggagacgcaccggcga
cagcggaggcggatgcagccagggttccaccgccagcgcctcgagagctatgtcgccacc
atggcggccgccgcgcaggagaccgctgattcctggagcgctgggcaggtggtggacgtt
gagcaggccgcctgcgacctgtcgcttgccatgatcacgaagacgctgttcttctccgac
ctgggcgcgaaggccgaggcggcgctgcggaaaaccggacacgacattctgaaggtggcc
cggctgagtgctctcgcccccaccctttacgaggttcttcccaccgcgggcaagcggtcc
gtgggccgtacgagcgcaacgatccgggaggcgatcacggcgtatcgcgccgatggccgc
gaccacggtgacctgctctcgacgatgctgcgcgcgacggacgccgaaggtgcctccatg
acggaccaggaggtccatgacgaggtcatgggaatcgcggtggccgggatcggcggccca
gctgccattacggcgtggattttccacgagctcggacagaacgccgagatcgagagtcgg
ctgcacgcagagctcgacacggtcctgggcgggcggttgcccacgcacgaggacctcccg
cggctgccgtacacacagaacctcgtgaaagaggcactgcgcaaataccccggctgggtg
gggtcccgccggacggtgcggcccgtacgactcggcggtcacgacctgcccgccgatgtg
gaggtcatgtacagcgcgtacgccatccagcgcgacccacgttggtaccccgaacccgaa
cgtctcgaccccggccgctgggaaaccaagggatcgagccgcggagttcccaagggggcg
tgggtgcccttcgcgctcggcacctacaaatgcatcggcgacaacttcgcccttctcgag
acggccgttacggtcgcggtcgtcgcctcccactggcgactacacgcccttccgggcgac
gaggtccggcccaagacgaaggccactcacgtcttccccaaccgactccgcatgatcgct
gaaccgaggagtgtggtgcgtctggaggagcccgccgccatgggagcgtga

DBGET integrated database retrieval system