KEGG   Streptomyces avermitilis: SAVERM_943
Entry
SAVERM_943        CDS       T00126                                 
Symbol
aveA4
Name
(GenBank) type I polyketide synthase AVES 4
  KO
K24569  avermectin polyketide synthase AveA4
Organism
sma  Streptomyces avermitilis
Pathway
sma00522  Biosynthesis of 12-, 14- and 16-membered macrolides
sma01052  Type I polyketide structures
sma01100  Metabolic pathways
Module
sma_M00777  Avermectin biosynthesis, 2-methylbutanoyl-CoA/isobutyryl-CoA => 6,8a-Seco-6,8a-deoxy-5-oxoavermectin 1a/1b aglycone => avermectin A1a/B1a/A1b/B1b
Brite
KEGG Orthology (KO) [BR:sma00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01052 Type I polyketide structures
    SAVERM_943 (aveA4)
   00522 Biosynthesis of 12-, 14- and 16-membered macrolides
    SAVERM_943 (aveA4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01008 Polyketide biosynthesis proteins [BR:sma01008]
    SAVERM_943 (aveA4)
Polyketide biosynthesis proteins [BR:sma01008]
 Polyketide synthase (PKS)
  Modular type I PKS
   cis-AT PKS
    Avermectin PKS
     SAVERM_943 (aveA4)
SSDB
Motif
Pfam: ketoacyl-synt Acyl_transf_1 Ketoacyl-synt_C KR PS-DH PP-binding KAsynt_C_assoc Thiolase_N adh_short Thioesterase adh_short_C2 Epimerase GDP_Man_Dehyd Docking PKS_DE ACP_syn_III Polysacc_synt_2 NmrA Abhydrolase_6 RmlD_sub_bind
Other DBs
NCBI-ProteinID: BAC68653
NITE: SAV0943
UniProt: Q79ZM6
LinkDB
Position
complement(1187928..1202573)
AA seq 4881 aa
MANEEKLRDYLKRVTADLLNVRRRLQQIESGEQEPIAIVGMACRFPGGVESAEDFWELIA
SGRDAVGEFPVDRGWDVEAFYDPEPGRAGSSYTRRGGFLEGAAEFDAGFFGISPREALAM
DPQQRLMLEVSWEALERAGIDPATLRGSRTGVFAGLMSQDYATRLLSVPDDLAGYLGNGN
AGSILSGRVAYTFGFEGPAVTVDTACSSSLVALHLACQSLRTGESSFALAGGVTVMSTPG
MFVEFSRQRGLSPDGRCKAYASAADGTGMSEGVGILLLERLSEAERRGHRVLAVVRGSAV
NQDGASNGLTAPNGPSQQRVIRQALACAGLSVADVDVVEGHGTGTTLGDPIEAQALLATY
GQRAGDTPVWLGSVKSNIGHAQAAAGVAGVIKMVMALRAGVLPRTLHVDEPSSQVDWSSG
SVRVLADEVEWPGVEGRLRRAGVSAFGVSGTNAHVILEEASGGAGGGAGRLQELGPGVVS
GSGVVPWVVSARSELALRGQARRLRGVVAVGGGADGVGVSPAGVGRALVSERSVFEHRAV
VVAEDRDEFLHALDALAGGRPVPGVVEGRTTSGELAVLFAGQGTQRAGMGRELYEAYPVF
AQAIDEICAEADTARTDPGAPGLRDVLFAPQDSPEGRLIEDTGFAQPALFAFEVALFRLL
ETWGLTPDYVLGHSVGELAAAHVAGMLCLADAVALVVARGRLMQGLPSGGAMVAIEASED
EILPLPDEYASRVAHAAVNGPRSIVLSGDEDAVLDLAQQWAARGRRTRRLRTSHAFHSPH
MDAMLGDFRRAAEQVTFSAPRIPVVSNVTGAPLPAETMCTPDYWVEHARSTVRFADGISW
LQEQGVTTCLEIGPDGTLSALAQDSLSAPARAIPALRPDQPEARSVMTALAELFVAGTAV
EWAGVFEGTAREVGDGCGVELPTYAFERERFWLDVEEGSAGGSGVSGMWGGPLWEAVECG
DAGVVASLLGVDEGASLGAVVSALGEWGRVRHEREVVDGWRYREVWRPVSGGGVGGLSGA
WLVVSEGEAGPVDVVAEGLERCGARVVRVEVEAGCVSREVLAGHLREAVDGEAVGGVVSL
VGWGSGVVQAGVASVGLVQALGDVGVGARLWCVTGGAVSVGGRDAVWGPASGVVWGLGRV
VGAEAPDRWGGLVDVPELVDERVVDGLVGVLAGVGGGGESEFAVRSSGAFVRRLVRAPLE
EAVAEREWRPRGTVLVTGGTGELGAHVARWMARRGAEHLLLVSRRGESAQGVEELRADLM
GLGARVSVVACDAADREALAEVLRSAVPAECPLGVVVHAAGVVDDGVLEGLSSERVTGVL
RAKALAAWNLHELTRGADLSGFVVFSSAAATFGPAGQGSYAAANAYVEAIVRHRRGEGLP
GLAVAWGPWAGGGMAEGAVGQMRRRGLAAMTPETALVALGQALDHDETCVTVADIDWDRF
TANSLPGSRLSPLISDIPEARLARETTGLDTATASPDSFSARLKAMDTAEQERALLDLVR
TYAATVLGHSTPTAVRPERAFRDLGFVSVSAVELRNRLNAVTGLLLPTTLIFDYPTPSAL
AGYLKEQLEEGAGGQRDIAPPVPASRVDVDEPIAIVGMACRFPGGVESAEDLWELVASGR
DAVGEFPVDRGWDVEAFYDPEPGRAGSSYTRRGGFLEGAAEFDAGFFGISPREALAMDPQ
QRLMLEVSWEALERAGIDPATLRGSTTGVFAGMCSQDYADLVRRATEDLEGYAMTGLSSS
VTSGRVAYTLGLEGPAVTVDTACSSSLVALHLACQALRSGECSLALAGGVTVMSTPGAFV
EFSRQRGLSPDGRCKAYGSGADGVGWAEGVGVLLVERLSEAERRGHRVLAVVRGSAVNQD
GASNGLTAPNGPSQQRVIRQALACAGLSVADVDVVEGHGTGTTLGDPIEAQALLATYGQG
RSGERPVWLGSVKSNIGHAQAAAGVAGVIKMVMALRAGVLPRTLHVDEPSSQVDWSSGSV
RVLADEVEWPGVEGRLRRAGVSAFGVSGTNAHVILEEASGGADGGAGRLQELGPGVVSGS
GVVPWVVSARSELALRGQARRLRGVVAVGGGADGVGVSPAGVGRALVSERSVFEHRAVVV
AEDRDEFLHALDALAEGAPTAGVVQGVAGPAADGKIAMLFGGQGTHWEGMAQELLGSSPV
FAQQMSDCAQALEPYLDWSLLDVLRGAPDAPPLQRVDVVQPVLFAVMVSLAALWRSYGVH
PDAVAGHSQGEIAAAYVAGALSLDDAARVTALRSQALAALAGQGAMASVGLPVEKLEPRL
ATWGDRLVIAAVNGARSAVVSGEPEAVDALVEELSHEDVPARRLMVDWASHSPQVEAIQG
RLLELLAPIRARTGDVPFYSTVTGERIDGTELDADYWYRNLRQVVRFRDATQALVRAGHT
VFIEACPHPAVAVGVQETLDEMGDLDSLVVGSLRRGEGGLRRFLMSVAELFVGGVAVEWS
GVFGSVGRGVAGGCGVELPTYAFERERFWLDVEGAPRGSGVSGQWGGQLSEAVDTVRGGM
LRDCLAGLDPAAQAETVLDLVLTHAAAVLGHGTADAVVPERAFRDLGFDSLTAVELRNRL
NTATGLRFPRTLVFDHPRPVALAAHIHEQLSGGSPTTGTALALALRAPAPRVDVDEPIAI
VGMACRFPGGVESAEDFWELIASGRDAVGEFPVDRGWDVEAFYDPEPGRAGTSYTRCGGF
LQGAAEFDAGFFGISPREALAMDPQQRLMLEVSWEALERAGIDPATLHGSTTGVFAGVSQ
QDYAELLRRGTQDHEGYALTGVSNSVVSGRLSYTFGFEGPAVTVDTACSSSLVALHLACQ
ALRSGECSLALAGGVTVMSTPGAFVEFSRQRGLSPDGRCKAYGSGADGVGWAEGVGVLLV
ERLSEAERRGHRVLAVVRGSAVNQDGASNGLTAPNGPSQQRVIRQALACAGLSVADVDVV
EGHGTGTTLGDPIEAQALLATYGQGRSGERPVWLGSVKSNIGHAQAAAGVAGVIKMVMAL
NHELLPTSLHIDEPSPHIDWSSGGVRLLTEPVPWQQNGRPRRAGVSAFGVSGTNAHVIIE
QAPVEAHVISEPVPAEAHVIVEQAPVEAPHVVDATGPADLTEPQEEAAEPECVADAVTEM
SAEPECVADAMSEMSAECVAEAVSDKSAEPECVADAMSDKPALLPIPWLLSAKSERALRG
QARRLRQFAARASDARPADVAHALAAQRSVFDHRAVVVAEDRDGFLQALDALAEGRSADG
LIEGSVGPRGGHSGRRRGKTAMLFAGQGTQRVGMGRQLYAAHPAYADALDQVLAELDGHL
DQPLRPLIHASADLADVADAADVLDRTRYAQPALFAVQVALFRHLERLGVRADFVAGHSI
GELAAAHVAGVLPLAAACRLVAARGRLMEQLAPGGAMVAVRASEAEARQALDGREARVSV
AAVNGPASVVFSGAEDEVGNMADWFAERGRRVKRLRTGHAFHSPLMDPMLEEFQQVAASL
TYSEPAIPMVSTLTGDIVAAGELSDPEYWVRQVRRTVRFGDAISRLHTDGVRTFMELGPD
GTLSALAEECLEATADSHPADDDTGTPQENLLIPLLRPDSPEPGTLLTGLARLHTHGAAA
VNWPAALPERDRARHLDLPTYAFDHHRYWVDTSAGHPGDLSAAGLGTAGHPLLGSAVALA
ESQELLFTGRLSLRTHPWLADHAIFGTVLLPGTAILELAVRAGDEVDCGTVEELTLRTPL
VLPEQGSVILQLSVGAPQGPQTPEEPERRTFALYAREDDGLSSSSAAATGTEWTCHATGV
LTGTARPAEEHTQEPWPPADAAPVDLDGWYEQLAGAGLGYGPVFQGLREVWRRGDEVFAV
VTLPESTEGQAADAARYALHPALLDAALHPVVLRHEGDAAADGHGWLPFSWTGVTVAASG
ASTLHVRLTVRTDEDAVGLLATDASGRIVISAGSLAFRPVSAEQLQAARTGYHDHLFRIE
WRPLHLPTTPARTADWALIGPGARRTAAVLERNGASWQAYPDPAALAEALAAGAPAPGMV
VISCEPDGASAPTDSALTDSALTDSAPAGSAPADSTALADATRQATTRVLALLQEWVADE
RLAACRLALLTHGSVTATPDEPVSDLAHAAVWGLVRSVQTENPDRFLLADTDDTDASRNA
LPLLAGEPQIALRNGAVRIPRMTRVPVRQPQPSTTDADWDPEATVLITGGTGVLGRLVAR
HLATAHGVRHLLLATRRGTAADGAADLVAELAGLGAEATVAACDIGDRAAVAALLDQVPA
QHPLKAVIHTAGVVDDGILTSLTPERMEAVLHAKAFGAAHLHDLTRDAGLTTFTVFSSAA
ASFGSPGQGNYTAANAFLDALMQHRHTQALPGRSLAWGLWGEADGMTRNLAGTDFARMAR
GGLLPLSNAQGLALLDTADRLGPFGDGLLLATRLDAATLHAQATAGALPRILHGLIRIPA
RRSADHGIATDTPATLRERLAGLTIPAQRTGLLLELVRTHAAAVLGHPTSAVTAADGALP
DDLVPADTEFRDLGFDSLTAVELRNRINAVTGLRLPATLIFDQPSPAALADHLATRLTAE
AGTPDEPAPAAAAAGAGSAGSAETGQQRSTGSEKQQTRGGTSTETVESLFWIGHDTRRIE
ESMALLSAASFFRPAFTDPSDIPEPTFVRLAQGEARAQGEALARGETRPALICLPTVAAV
SSVYQYSRFAAGLNGHRDVWYVPAPGFLEGEPLPSGIGAVTRMFADAIVRFTDGAPFALA
GHSAGGWFVYAVTSHLERLGVRPEAVVTMDAYLPDDGIAPVASALTSEIFDRVTQFVDVD
YTRLVAMGGYFRIFSGWSPPDITTPALFLRGRDGEQMPPPWGVPHTVLDIQGNHFTMLEQ
FADSTARHVDEWLTEIASVRR
NT seq 14646 nt   +upstreamnt  +downstreamnt
atggctaacgaggaaaagctccgcgactatctcaagcgcgttactgccgatctcctcaat
gtgcggcgtcgacttcagcagattgaatcgggcgagcaggagccgattgcaattgtgggg
atggcgtgccgttttccggggggtgtggagtcggcggaggatttctgggagttgattgcg
tcgggtcgggatgcggtgggggagtttccggtcgaccggggttgggacgtggaggctttc
tatgatccggagccggggcgggcgggttcgtcgtatacgcgccggggcggtttcctggag
ggtgcggcggagttcgatgcggggtttttcgggatcagtccgcgtgaggcgttggcgatg
gatccgcagcagcggttgatgctggaggtgtcctgggaggcgttggagcgggcgggcatc
gaccccgccacgttgcgcggcagccggacgggcgtcttcgccggcctcatgtcccaggac
tacgcgacccgtctgctctcggtccccgacgacctggccggctacctgggcaacggcaac
gcgggaagcatcctgtccggacgcgtcgcctacaccttcggcttcgagggccccgcggtg
acggtcgacacggcgtgctcgtcgtcgctggtggcactgcacctcgcctgccagtcactg
cgcaccggtgagtcctccttcgccctcgccggaggcgtgacggtcatgtccaccccgggc
atgttcgtggagttctcgcggcagcggggtctgtcgccggacggccggtgcaaggcgtac
gcgtcggctgccgacggcaccggcatgtccgagggcgtggggattttgctgctggagcgg
ctgtccgaggctgaacgtcgtggtcatcgggttttggcggtggtgcgggggagtgcggtg
aatcaggacggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcagcgggtg
attcggcaggcgttggcgtgtgcggggttgtctgtggcggatgtggatgtggtggagggg
cacgggacgggcacgacgctgggtgatccgatcgaggcgcaggcgttgctcgccacgtac
gggcagcgggccggtgacacgccggtgtggttggggtcggtgaagtcgaacatcgggcat
gcgcaggctgctgcgggtgtggcgggtgtgatcaagatggtgatggcgttgcgggcgggg
gtgttgccgcggacgttgcatgtggatgagccgtcgtcgcaggtggattggtcgagtggg
tcggttcgtgtgttggcggatgaggtggagtggccgggggtggagggtcggctgcggcgt
gcgggggtgtctgcgttcggggtgagtgggacgaatgcgcatgtgattttggaggaggcg
tcggggggcgcgggtgggggtgcgggccggctgcaggagttgggtccgggggtggtgtcg
ggttcgggggtggtgccgtgggtggtgtcggcgcggtcggagttggcgttgcgggggcag
gcgcgtcggttgcgtggggttgtggcggttggtgggggtgcggatggtgtgggggtgagt
ccggctggggtcgggcgggctttggtgtcggagcggtcggtgttcgagcatcgtgcggtg
gtcgtggccgaggaccgcgacgagttcctgcacgcactcgacgcactggccggcggccgc
cccgtgcccggcgtcgtcgagggacgaaccacctcgggcgaactcgccgtactcttcgcc
gggcagggaacccagcgcgcaggcatgggccgcgaactgtacgaggcgtaccccgtcttc
gcccaggccatcgacgagatctgcgcggaggccgacaccgcccgcaccgaccccggtgcc
cctgggctgcgggacgtactcttcgcaccgcaggactctcccgaaggccggctgatcgag
gacacgggtttcgcccagcccgccctgttcgccttcgaggtggcgctgttccggctgctg
gagacctggggtctgacgcccgactacgtcctcggccattccgtcggtgaactggcggcc
gcccatgtcgccgggatgctctgccttgccgacgcggtggcactggtggtcgcacgaggc
cgcctgatgcaagggctcccgtccggcggagccatggtggccatcgaggcgtccgaggac
gagatcctcccgctgcccgacgaatacgcatcccgggtcgcgcacgccgcggtgaacggg
ccgcggtcgatcgtcctctccggggacgaggacgcggtcctggacctcgcgcagcaatgg
gcggcacgaggccgccgcacccggcggctgcggaccagccacgccttccactcgccgcac
atggacgccatgttgggcgacttccgccgcgcggccgagcaggtcaccttcagcgccccg
cggattcccgtcgtctccaacgtcaccggcgcgcccctccccgccgagaccatgtgcacc
ccggactactgggtcgaacacgcccgcagcacggtccgtttcgcggacggcatctcatgg
cttcaggaacagggcgtcaccacctgcctcgaaatcggccccgacggcacgctgtcggcc
ctcgcacaggactcgctcagtgcaccggcccgcgccatccccgccctgcggccggaccag
ccggaggcacggtcggtcatgaccgccctggcggagttgttcgtggctgggacggcggtt
gagtgggccggtgtgttcgaggggactgctcgcgaggtcggtgatggatgcggggtggag
ctgccgacgtatgcgtttgagcgggagcgattttggctggacgtggaggagggatctgcg
ggaggttccggggtttccgggatgtggggtggtccgttgtgggaggcggtcgagtgtggt
gatgcgggggtggtggcatcgctccttggggtggatgagggggcgtcgctgggtgcggtg
gtgtcggcgttgggggaatgggggcgggtacggcacgagcgtgaagtggtggacgggtgg
cgctatcgggaggtgtggcgacccgtttcgggcggtggtgtaggggggctgtcgggcgcg
tggctggtggtgtccgagggcgaggcgggcccggttgatgtggtggcggaggggttggag
cggtgtggggcgcgagtggttcgggtggaggtggaagcggggtgtgtgagcagggaagtg
ttggccggccacctgcgtgaggcggtcgatggtgaggctgtcggcggtgtcgtctccctt
gtgggctgggggagtggcgtcgtgcaggcgggagtggcgtctgtggggttggtgcaggcg
ctgggtgatgtgggcgtgggggcgcggctgtggtgtgtgacgggcggggccgtgtcggtg
gggggccgggatgctgtgtgggggccggcctcgggtgtggtgtgggggctgggccgtgtg
gtgggggcggaggcaccggaccgctggggtgggctggttgatgtgccggagctcgtggat
gagcgggtggtcgatgggttggtaggtgtgctggcgggtgtggggggagggggtgagagt
gagtttgccgtgcggtcttcgggggcgtttgtgcggcggttggtgcgggcgccgttggag
gaggccgtcgcggagcgggagtggcggccccgcggcaccgtactcgtcaccggaggcacc
ggcgagttgggtgcgcacgtcgcccggtggatggcccggcgtggcgccgaacacctgctg
ctggtgagccgacgcggggagagcgcccagggagtcgaagaactccgagcggacttgatg
ggcttgggcgcgcgggtgtcggtggtggcgtgtgatgcggcggaccgtgaggcgttggcg
gaggtgttgcggtcggccgttccggcggagtgcccgctgggtgtggtggtgcatgccgcg
ggagttgtggatgacggggtgttggaggggttgtcgtccgagcgtgtcacgggggtgctg
cgggcgaaggcgctggcggcctggaatctgcatgagttgacgcggggggcggatctttcg
gggttcgtggtgttctcgtcggctgcggcgacgttcgggccggcgggacaggggagttac
gcggcggcgaacgcgtatgtggaggcaatcgttcggcaccggcgtggtgagggcctgccg
gggttggcggtggcgtggggtccgtgggctggtggggggatggcggagggggccgtgggg
cagatgcggcgtcggggtctggcggcgatgacgccggagacggcgctggtggcactgggc
caggcgttggaccatgacgagacctgtgtgacggtcgccgacatcgactgggaccgattc
accgccaactccctccccggctcccgactctcgcccctcatcagcgacatccccgaagca
cgcctcgcccgggaaaccaccggactcgacaccgccaccgcatcccccgactcgttctcc
gcacggctcaaggccatggacaccgccgagcaggaacgtgcgcttctcgacctggtccgt
acgtacgcggcgaccgtgctcggacacagcacccccaccgccgtacgccctgagcgagcc
ttccgcgacctgggcttcgtctccgtgagcgccgtcgaactgcgcaaccgcctcaacgcc
gtcaccgggctcctcctgcccaccacgctgatcttcgactaccccactccctccgcgctg
gccggatacctcaaggaacagctggaggagggcgcgggcggccagcgtgacattgctcct
ccggtcccggcgtcgcgtgtcgacgttgacgagccgattgcgattgtggggatggcgtgc
cgttttccggggggtgtggagtcggcggaggacttgtgggaactggtcgcgtcgggtcgg
gatgcggtgggagagtttccggtcgaccggggttgggacgtggaggctttctatgatccg
gagccggggcgggcgggttcgtcgtatacgcgccggggcggtttcctggagggtgcggcg
gagttcgatgcggggtttttcgggatcagtccgcgtgaggcgttggcgatggatccgcag
cagcggttgatgctggaggtgtcctgggaggcgttggagcgggcgggcatcgaccccgcc
acgttgcgcgggtccacgaccggtgtcttcgccggcatgtgcagtcaggactacgccgac
ctcgtgcgccgggccaccgaggacctcgagggctacgccatgacgggcctgtccagcagc
gtcacatccggacgcgtcgcctacaccctggggctcgagggtccggcggtgacggtggat
acggcgtgttcgtcgtcgttggtggcgctgcatctggcgtgtcaggcgttgaggtcgggg
gagtgttcgctggcgttggcggggggtgtgacggtgatgtcgacgccgggtgcgtttgtg
gagttctcgcggcagcggggtctgtcgccggacggccggtgcaaggcgtacgggtcgggg
gccgatggggtcggctgggccgagggtgtgggtgtgctgttggtggagcggctgtccgag
gctgaacgtcgtggtcatcgggttttggcggtggtgcgggggagtgcggtgaatcaggac
ggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcagcgggtgattcggcag
gcgttggcgtgtgcggggttgtccgtggcggatgtggatgtggtggaggggcacgggacg
ggtacgacgttgggtgatccgatcgaggcgcaggcgttgctcgccacttatgggcagggt
cgttcgggggagcggccggtgtggttggggtcggtgaagtcgaacatcgggcatgcgcag
gctgctgcgggtgtggcgggtgtgatcaagatggtgatggcgttgcgggcgggggtgttg
ccgcggacgttgcatgtggatgagccgtcgtcgcaggtggattggtcgagtgggtcggtt
cgtgtgttggcggatgaggtggagtggccgggggtggagggtcggctgcggcgtgcgggg
gtgtctgcgttcggggtgagtgggacgaatgcgcatgtgattttggaggaggcgtccggg
ggcgcggatgggggtgcgggccggctgcaggagttgggtccgggggtggtgtcgggttcg
ggggtggtgccgtgggtggtgtcggcgcggtcggagttggcgttgcgggggcaggcgcgt
cggttgcgtggggttgtggcggttggtgggggtgcggatggtgtgggggtgagtccggct
ggggtcgggcgggctttggtgtcggagcggtcggtgttcgagcatcgtgcggtggtcgtg
gccgaggaccgcgacgagttcctgcacgcactcgacgcactggccgagggggcacccacc
gcgggggtggtacagggtgtggccggaccggcggccgacggaaagatcgccatgctgttc
ggaggacagggcacccactgggaaggcatggcgcaggaactcctcggctcctcaccggtc
ttcgcccagcagatgtccgactgcgcccaagccctcgaaccgtacctggactggtctctc
ctcgacgtcctgcgcggcgcaccggacgcaccccctctgcaacgcgtcgatgtcgtccag
cccgtcctcttcgcggtgatggtctcgctggcggcgctctggcgctcgtacggtgtacac
ccggacgcggtggccgggcactcgcagggcgagatcgcagcggcctacgtcgccggtgca
ctctccctcgacgacgccgcccgggtcaccgccctgcgcagccaggcgctggccgcactg
gccgggcagggggcgatggcatcggtcggtctgccggtcgagaagctggagccgcgtctt
gcgacatggggcgaccgtctggtcatcgccgccgtgaacggggcgcgttcggccgtggtc
tccggggagccggaagcggtcgacgccctggtggaggagctgtcacacgaagacgtaccg
gcccgcaggctcatggtcgactgggcgtcgcactccccgcaggtcgaggcgatccagggg
cggctgctcgaactcctcgcccccatccgcgcgaggaccggcgacgtgcccttctactcc
accgtcaccggcgaacgcatcgacggcaccgaactcgacgccgactactggtaccgcaac
ctgcgccaggtcgtccgcttccgggacgcgacacaggcgctggtccgcgccggccacacc
gtcttcatcgaggcgtgcccgcatccggccgtcgcggtcggtgtgcaggaaaccctggac
gagatgggtgacttggacagcctggtcgtcggatctctgcgccggggcgaaggcggcttg
cgacgcttcctgatgtccgtggccgagttgttcgtgggtggggtggcggttgagtggtcc
ggtgtgttcgggagtgttggtcgcggggtcgctggtggttgcggggtggagctgccgacg
tatgcgttcgagcgagagcgcttttggctggatgtggagggggcgccgcggggttccggg
gtctctgggcagtggggtggtcagttgtcggaggcggtggacaccgtgcgcggcggcatg
ctgcgcgactgcctcgccggactcgaccccgccgcacaggccgagaccgtgctggacctg
gtccttacccatgccgcggccgtccttggacacggcaccgccgatgcggtggtgcccgag
cgcgccttccgcgacctcggtttcgactccctcaccgccgtcgaactacgcaaccgcctc
aacaccgccacgggcctgcgcttcccgaggaccctggtgttcgaccatccccgcccggtg
gcactcgcggcacacatccacgagcagctgagcggcggaagcccgaccaccggcactgcc
cttgcccttgcccttcgggccccggcaccgcgtgtggatgtcgacgagccgattgccatt
gtggggatggcgtgccgttttccggggggtgtggagtcggcggaggatttctgggagttg
atcgcgtcgggtcgggatgcggtgggggagtttccggtcgaccggggttgggacgtggag
gctttctatgatccggagccggggcgggcgggtacgtcctacacgcggtgtggtgggttt
ttgcagggtgcggcggagttcgatgcggggtttttcgggatcagtccgcgtgaggcgttg
gcgatggatccgcagcagcggttgatgctggaggtgtcctgggaggcgttggagcgggcg
ggcatcgaccccgccacgctgcacgggtccacgaccggtgtcttcgccggcgtctcgcag
caggactacgccgagctcctgcgccgcggcacccaggaccacgaggggtacgcgctcacc
ggcgtctccaacagcgtcgtctccgggcggctttcctacaccttcggcttcgagggtccg
gcggtgacggtggatacggcgtgttcgtcgtcgttggtggcgctgcatctggcgtgtcag
gcgttgaggtcgggggagtgttcgctggcgttggcggggggtgtgacggtgatgtcgacg
ccgggtgcgtttgtggagttctcgcggcagcggggtctgtcgccggacggccggtgcaag
gcgtacgggtcgggggccgatggggtcggctgggccgagggtgtgggtgtgctgttggtg
gagcggctgtccgaggctgaacgtcgtggtcatcgggttttggcggtggtgcgggggagt
gcggtgaatcaggacggtgcgtcgaatgggttgacggcgccgaatggtccgtcgcagcag
cgggtgattcggcaggcgttggcgtgtgcggggttgtccgtggcggatgtggatgtggtg
gaggggcacgggacgggtacgacgttgggtgatccgatcgaggcgcaggcgttgctcgcc
acgtacgggcagggtcgttcgggggagcggccggtgtggttggggtcggtgaagtcgaac
atcgggcatgcgcaggctgccgcgggtgtggccggtgtgatcaagatggtcatggccctg
aaccacgaactgttgccgaccagcctgcacatcgacgaaccctccccccacatcgactgg
tcgagcggcggcgtccggcttctcaccgagcccgtaccgtggcagcagaacggccggccc
aggcgcgcgggcgtctccgcgttcggagtcagcgggaccaacgcccacgtcatcatcgag
caggcgccggtcgaggcgcacgtcatcagtgagccggtaccggctgaggcgcacgtcatc
gtcgagcaggcgccggtcgaggcgccccacgtggtcgacgccaccggaccggcggacctc
accgagccgcaagaggaggcggctgaaccggagtgcgtcgctgacgccgtgaccgagatg
tcggctgaaccggagtgcgtcgccgacgccatgtccgagatgtcggctgagtgcgtcgcc
gaggccgtgtccgacaagtcggctgaaccggagtgcgtcgccgacgccatgtccgacaag
ccggccctcctgcccatcccgtggctgctctccgccaagtccgagcgagcgctgcggggc
caggcgcgacggttgcggcagttcgctgccagggcatccgatgcccggccggccgacgtg
gcgcacgccctggcggcacagcggtccgtgttcgatcaccgggccgtcgtcgtggccgag
gaccgcgacggcttccttcaggccctcgacgcgctggccgagggccggtcggcggacggc
ctgatcgaagggtcggtcggcccgcgtggcggccactcaggccgccggcgcggaaagacc
gccatgctgttcgccggacagggcacgcaacgcgtgggaatgggccgtcagctgtatgcg
gctcacccggcctacgcggacgcgctggaccaggtactggcggaactggacggtcacctg
gaccagcccctgcgcccgctgatccacgccagtgcggatcttgcggatgtcgcggatgcc
gcggatgttctggaccgtacgcggtacgcccagccggcgctgttcgccgtccaggtcgcg
ctcttccggcacctggaacgtctcggcgtgcgcgcggacttcgtggccgggcactcgatc
ggcgagctcgcggccgcccacgtcgccggggtgcttcccctggcagcagcctgccgcctg
gtggcggcccgcgggcgcctgatggagcagctcgcaccaggcggcgccatggtcgccgta
cgggcgagcgaagccgaggcgcgacaggcgctcgacggccgggaagcccgggtgtcggtc
gcggccgtgaacggacccgcctcggtggtgttctccggcgccgaggacgaggtggggaac
atggcggactggttcgccgagcgcgggcggagagtcaagcgcctgcgaaccgggcatgcc
ttccactcaccgctgatggacccgatgctggaggagttccagcaggtcgcggcctcgctg
acctacagcgaaccagccattcccatggtgtcgacgctcaccggcgacatcgtggcggcg
ggagaactgagcgaccccgagtactgggtccggcaggtacggcggaccgtgcgcttcggc
gacgcgatcagccgcctgcacaccgacggagtccgcaccttcatggaactgggcccagac
gggaccctgtcggcactggccgaggaatgcctagaggccaccgccgacagccaccccgcc
gacgacgacaccggcaccccgcaagagaacctgctcatcccgctcctacggccggacagc
ccggaacccggcaccctgctcaccggcttggcccggctgcatacgcacggagcggcggcg
gtcaactggcccgccgccctgcccgaacgcgatcgagcccgccacctcgacctgccgacc
tacgccttcgatcaccaccgctactgggtcgacacctcggccggccacccgggggacctg
tcggcagcggggctcggcaccgccgggcatcccctgctcggttccgcggtggcactggcc
gagtcgcaggaactcctcttcaccggccgtctctccctgcgcacacacccgtggctggcc
gaccacgccatcttcggtaccgtcctgctgcccggcacggccatcctggaactggccgtg
cgcgcaggcgacgaggtcgactgcggcaccgtcgaggaactcaccctgcggacaccgctc
gtccttcccgaacagggctcggtgatcctgcaactctccgtcggggcaccccagggcccc
cagacgcccgaggagcccgaacggcgcaccttcgccctgtacgcccgcgaagacgacgga
ctgtcgtcctcgtccgcggcggcgaccggcaccgagtggacctgccacgccaccggcgtc
ctgaccggcaccgcccggcccgcggaggagcacacacaggaaccgtggccgcccgccgac
gcagcaccggtggacctggacggctggtacgagcagctggccggcgccggcctgggatac
gggccggtgttccaggggctgcgcgaggtctggcggcgcggggacgaggtgttcgccgtc
gtcaccctgcccgagagcacggagggacaggcggccgacgccgcccggtacgccctgcac
ccggccctgctggacgcggcactgcacccggtcgttctgcgccacgagggcgatgccgcc
gccgacggacacggctggctgccgttctcctggaccggcgtcacggtcgccgcctccggc
gcctccaccctgcacgtccgtctcaccgtccgcacggacgaggacgcggtcggactgctg
gccaccgacgcatcgggacgcatcgtcatctccgcggggtccctcgccttccggcccgtc
tccgccgagcagctccaggccgcgcgcaccggctaccacgaccacctcttccgcatcgaa
tggcggccgctgcacctccccaccacaccggcacggacagccgactgggccctaatcggc
cccggtgcccggcggacggccgccgtcctggagcgcaacggcgcctcctggcaggcctac
ccggacccggcggctctcgcagaagccctggcggccggcgccccggcaccgggcatggtc
gtcatctcgtgcgagccggacggcgcatccgcccccaccgattccgccctcaccgattcc
gccctcaccgattccgccccggccggctcggccccggccgactccaccgccctcgccgac
gccacccggcaagccaccacccgcgtcctcgccctgctccaggaatgggtcgccgacgaa
cggctcgcggcctgccgcctggccctcctcacgcacggctcggtcaccgcgacccccgac
gagcccgtgtccgacctcgcacacgccgccgtctggggactggtccgctccgtgcagacc
gagaaccccgaccggttcctgctggccgacaccgacgacaccgacgcctcccgcaacgcc
cttcccctgctggccggggaaccgcagatcgccctgcgaaatggtgccgtccgcatcccg
cggatgacacgagtgcccgtccggcagccacagccgagcaccaccgacgccgactgggac
ccggaggccacggtcctcatcacgggcggtaccggcgtcctcggccggctcgtcgcccgt
catctcgccacggcccacggggtacggcacctgctgctggccacccgccgcggcacggcc
gcggacggcgccgccgacctggtcgccgaactcgccggcctcggcgccgaggccacggtc
gcggcctgcgacatcggggaccgggcggccgtcgccgcgctcctcgaccaagtgcccgcg
cagcaccccctgaaagccgtgatccacacggccggtgtggtcgacgacggcatcctcacc
tcgctcactccggagcgcatggaggccgtcctgcacgcgaaggcgttcggcgccgcgcac
ctgcacgacctgacccgcgacgccggcctcaccaccttcaccgtcttctcctcggccgcc
gcctccttcggcagtcccggacagggcaactacaccgcggcgaacgcctttctggacgcc
ctgatgcagcaccgccacacccaggcactgccgggccggtcgctcgcctggggcctttgg
ggcgaggccgacggcatgacccgcaacctcgccggcaccgacttcgcgcgcatggcccgc
ggcggcctgctccccctgtccaacgcacagggactcgcgctcctcgacacagcggatcgc
ctcggccctttcggtgacgggctgctcctcgccacccggctcgacgcggccaccctccac
gcacaggccacggccggcgccctgccgcgcatcctgcacgggctgatccgcatcccggcc
cggcggtccgccgaccacggcatcgcgaccgacacccccgccacgctgcgcgagcgcctg
gccggactcaccatccccgcgcagcgcaccggtctcctcctggaactcgtacggacccat
gccgccgccgtcctcggccaccccaccagcgccgtcacagccgcggacggcgcactcccg
gacgatctggtcccggccgacaccgagttccgcgacctcggcttcgactcgctgaccgcc
gtcgaactccgcaaccggatcaacgccgtcaccggcctgcgcctcccggcaacgctcatc
ttcgaccagcccagccccgcggcactcgccgatcacctcgcgacccgcctgacggccgag
gcgggcacgccggacgagccggcccctgccgccgcggcagccggggccgggagcgcaggg
agtgccgagaccggacagcagcgcagtacggggagcgagaagcagcagaccaggggcggc
acctccaccgaaaccgtcgaatccctgttctggatcggacacgacacccgccgcatcgag
gagtccatggccctgctctcggcggcctccttcttccggcccgccttcacggacccctcg
gacatcccggagccgacgttcgtccggctcgcccagggtgaagcgcgcgcccaaggtgaa
gcactcgcccggggcgaaacacggcccgccctcatctgcctgcccaccgtcgccgccgtg
tcgagcgtgtaccagtactcacgtttcgcggcgggactgaacggacaccgagacgtctgg
tacgttcctgcgccagggttcctggagggcgaacccctgccgtccggaatcggcgcggtg
acccgcatgttcgccgacgcgatcgtccggttcaccgacggcgcgccttttgcgctcgcc
gggcattccgcgggcggatggttcgtctacgcggtgacgagtcatctggagcgtctaggc
gtccgtccggaagcggtggtgaccatggacgcctatctcccggacgacggcatcgcacct
gtcgcgtccgcgctgacaagtgaaatcttcgaccgcgtcacgcagtttgtggacgtggac
tacacacgcctggtcgccatgggcggatacttccgcatcttctccggctggagtcctccg
gacatcaccacacccgccctcttcctgcgcggccgggacggagaacagatgccgccgccg
tggggagttccgcacaccgttctggacatccaggggaatcacttcacgatgctggaacag
tttgcggattcgactgctcggcatgtcgacgaatggctgacagaaatcgcatcagtgcgg
cgctga

DBGET integrated database retrieval system