KEGG   Streptomyces malaysiensis: SMALA_0742
Entry
SMALA_0742        CDS       T05189                                 

Definition
(GenBank) GGDP cyclase in cyclooctatin biosynthesis
  KO
K18686  cyclooctat-9-en-7-ol synthase [EC:4.2.3.146]
Organism
smal  Streptomyces malaysiensis
Pathway
smal00999  Biosynthesis of various secondary metabolites - part 1
smal01100  Metabolic pathways
smal01110  Biosynthesis of secondary metabolites
Module
smal_M00921  Cyclooctatin biosynthesis, dimethylallyl-PP + isopentenyl-PP => cyclooctatin
Brite
KEGG Orthology (KO) [BR:smal00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00999 Biosynthesis of various secondary metabolites - part 1
    SMALA_0742
Enzymes [BR:smal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.146  cyclooctat-9-en-7-ol synthase
     SMALA_0742
SSDB
Motif
Pfam: Terpene_syn_C_2
Other DBs
NCBI-ProteinID: ATL80977
UniProt: A0A291SJE6
LinkDB
Position
1074161..1075084
AA seq 307 aa
MTTGPSTAGAQDISRTSVRPYLEECTRRFQEMFDRYVVTRPTKVELTDAELREVIDDCNA
AVAPLGKSVSDERWISYVGVVLWSQSPRHIKDMEAFKAVCVLNCVTFVWDDMDPALHDFD
LFLPQLRKICEKYYGPEDAEVAYEAARAFVTSDHMFRDSPIKAALCTTSPEQYFRFRVTD
IGVDFWMKMSYPIYRHPEFTEHAKTSLAARMTTRGLTIVNDFYSYDREVSLGQITNCFRL
CDVSDETAFKEFFQARLDDMIEDIECIKAFDQLTQDVFLDLIYGNFVWTTSNKRYKTAVN
DVNSRIR
NT seq 924 nt   +upstreamnt  +downstreamnt
atgacgaccggaccttccacggccggggcccaggacatcagccggaccagcgtccgcccg
tacctggaggagtgcacccgccgcttccaggagatgttcgaccgctatgtcgtcacccgg
cccaccaaggtcgaattgaccgacgccgaactgcgcgaggtcatagacgactgcaacgcg
gcggtggcccccctcggcaaatcggtttccgatgagcgctggatctcctatgtgggggtg
gtgctctggtcccagagcccccgccatatcaaggacatggaggcgttcaaggccgtctgc
gtcctgaactgcgtgaccttcgtatgggacgacatggatcccgcgctgcacgacttcgat
ctcttcctgccccagctgcgcaagatctgcgagaagtactacggccccgaggacgcggag
gtcgcgtacgaggcggcgcgcgccttcgtcaccagtgatcacatgttccgcgactcaccc
atcaaggcggcgctgtgcaccacgtccccggagcagtatttccgtttccgggtcacggac
atcggtgtcgacttctggatgaagatgtcgtatccgatctaccggcatccggagttcacc
gaacacgccaagacaagcctggccgcacggatgaccacccgcggactcaccatcgtcaac
gacttctactcctatgaccgcgaggtctccctgggacagatcaccaactgtttccggctc
tgcgatgtgagcgacgagacggcgttcaaggagttcttccaggcccgcctcgacgacatg
atcgaggacatcgagtgcatcaaggcgttcgaccagctgacgcaggacgtcttcctcgat
ctgatctacggcaacttcgtctggaccaccagcaacaagcgctacaagacggccgtcaac
gacgtcaactcccgcatccggtga

DBGET integrated database retrieval system