KEGG   Streptomyces marincola: CAG99_12145
Entry
CAG99_12145       CDS       T08123                                 
Name
(GenBank) cyclase
  KO
K15885  C7-C12 aromatase (ARO/CYC) [EC:4.2.1.-]
Organism
smao  Streptomyces marincola
Pathway
smao01056  Biosynthesis of type II polyketide backbone
smao01100  Metabolic pathways
smao01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:smao00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   01056 Biosynthesis of type II polyketide backbone
    CAG99_12145
Enzymes [BR:smao01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     CAG99_12145
SSDB
Motif
Pfam: Polyketide_cyc2 Polyketide_cyc
Other DBs
NCBI-ProteinID: ARQ69516
UniProt: A0A1W7CXR1
LinkDB
Position
2791520..2792467
AA seq 315 aa
MADTGPRETEHTITVAAPAAAVYDLVADVSHWPSVFPPTLHAERVDGDDSQERIRIWATA
NGTPKSWTSRRNLDPAGLRVTFRQEVSAHPVAAMGGAWIIEPLAADRSRVRLLHDYRAVD
DAPDALEWIDRAVDRNSRTELAALKASAELAAGAEERTFTFEDAVRVNGPAKDVYDFLDE
AARWPERLPHVARVALTEEAPGLQRLEMDTRAKDGSAHTTVSFRVCFPHHAIVYKQTTLP
ALMTLHTGRWSLTEHADGSTTAVSRHTVTIDTDRITDVLGPDADLAVARARVRDALGTNS
RATLELARAHAERNR
NT seq 948 nt   +upstreamnt  +downstreamnt
gtggccgacacaggaccgcgagagacagaacacacgatcacggtggccgcgccggccgcc
gccgtctacgacctcgtcgccgacgtgtcccactggccgtcggtcttcccgccgaccctg
cacgccgaacgcgtcgacggcgacgactcgcaggagcgcatccgcatctgggcgaccgcc
aacggcacgccgaagagctggacttcgcgccggaacctcgacccggcgggcctgcgcgtc
acgttccgccaggaggtctccgcgcacccggtcgcggccatgggcggcgcctggatcatc
gagccgctggccgccgaccgctcgcgggtgcggctgctgcacgactaccgcgccgtcgac
gacgcgcccgacgcgctggagtggatcgaccgggccgtcgaccgcaacagccgcacggag
ctggccgcgctcaaggcgagcgcggagctggccgcgggcgccgaggagcgcaccttcacc
ttcgaggacgcggtgcgcgtgaacggcccggccaaggacgtctacgacttcctcgacgag
gcggcgcgctggccggaacggctcccgcacgtggcgcgcgtcgccctcaccgaggaggcg
cctgggctccagcggcttgagatggacacgcgcgccaaggacggctcggcccacacgacc
gtgtccttccgcgtgtgcttcccgcaccacgcgatcgtctacaagcagaccacgctgccc
gcgctgatgaccctgcacaccggccgctggtcgctgacggagcacgcggacggctcgacc
acggccgtctcccggcacaccgtgaccatcgacaccgaccggatcaccgacgtgctcggc
ccggacgccgacctcgccgtggcgcgggcccgggtccgcgacgcgctcggcaccaacagc
cgcgccacgctcgaactcgcccgcgcgcacgcggaacggaaccgctga

DBGET integrated database retrieval system