KEGG   Streptomyces marincola: CAG99_20095
Entry
CAG99_20095       CDS       T08123                                 
Name
(GenBank) hypothetical protein
  KO
K11943  PAH dioxygenase large subunit [EC:1.13.11.-]
Organism
smao  Streptomyces marincola
Pathway
smao00624  Polycyclic aromatic hydrocarbon degradation
smao01100  Metabolic pathways
smao01120  Microbial metabolism in diverse environments
smao01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:smao00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00624 Polycyclic aromatic hydrocarbon degradation
    CAG99_20095
Enzymes [BR:smao01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.-
     CAG99_20095
SSDB
Motif
Pfam: Rieske Ring_hydroxyl_A
Other DBs
NCBI-ProteinID: ARQ70836
UniProt: A0A1W7D1D3
LinkDB
Position
4611584..4613077
AA seq 497 aa
MDFRRDCPAGAARIPAFRSAFTLRDFHYRRLRNAQHLYPVMGFSRRRGSVSFGVDGSVRA
VGRRAFIDDDVLGDEFDRVFHPSWQLLGFADEVREPGDYIVRTLGRDEVVVMRGEDGVVR
ALHNSCTHRGTRLCRASLGNAAHLRCSYHGWTFANDGRLVGVPALRSAYPADFDPGGHGL
PTARVEDRRGFLFATWDAGAPGLDEYLGEIGWYLDAFLDCGAGRWEVWGPPQRVRTRGNW
KIPTDNFAGDGYHMRTTHQIALQQGIYGDTLADGTRGRSGTDLVAVNIATPGGHSVRAGY
VVESGRSIDDRDLAAPEFPGYPPERWADLAAAQTPEQVRFTSHCEVAHGVLFPNTVFLSV
AHDRAVGEDTDPLTRFLVVRTHVPISARETECLYWTLVPTAMDPEWRQRSYRFQARTQSA
GGILFEMDDFENFARIDAALARSAPDRGAPVDLSLGADRGVVAKDFPGPARAEVGTLSEH
NQRAFYRRWAELMGELP
NT seq 1494 nt   +upstreamnt  +downstreamnt
atggattttcgacgcgattgcccggcgggggccgcgcgtatacctgcctttcgcagtgcg
ttcacgcttcgcgatttccactacaggcgattgcggaatgcgcagcatttataccctgtc
atgggattttctcggaggaggggttccgtgtccttcggagtcgatggttccgtgcgcgcg
gtcggtcgtcgtgcgtttattgacgacgatgtactcggcgacgagttcgaccgagttttc
catccttcctggcagcttctcggatttgccgacgaggtgcgagaacccggcgattacatc
gtgcgcaccctcggcagggacgaagtcgtcgtcatgcggggtgaggacggagtcgtgcgc
gcgctgcacaattcctgcacccatcgcggcacccgcctgtgccgcgcgagcctgggcaac
gccgcgcacctgcggtgcagttaccacggatggacgttcgccaacgacggccggctggtc
ggcgtgcccgcgctcaggtcggcctacccggcggacttcgaccccggcggacacggcctg
cccaccgcgcgcgtcgaggaccggcgcgggttcctcttcgccacgtgggacgccggagcc
ccaggacttgatgagtacctgggggagatcggctggtacctcgacgccttcctcgactgc
ggggccgggcggtgggaggtgtggggaccgccgcagcgggtgcgcaccagggggaactgg
aagattccgacggacaacttcgcgggcgacggctaccacatgcgcaccacccaccagatc
gcgctccagcagggcatctacggtgacacgctggccgacggcacccgggggcgctcggga
accgacctcgtcgcggtcaacatcgccacccccggcgggcacagcgtgcgggccgggtac
gtcgtcgagagcgggcgttcgatcgacgaccgggacctggccgcccccgagttccccggc
tacccgcccgagcgctgggccgacctggctgcggcgcagaccccggagcaggtgcggttc
acctcgcactgcgaggtcgcgcacggggtgctgttccccaacaccgtgttcctcagcgtc
gcgcacgaccgcgcggtgggcgaggacaccgatccgctgacgcgcttcctcgtggtccgc
acccacgtgccgatcagcgcgcgcgagaccgagtgcctgtactggacgctcgtgcccacc
gcgatggaccccgagtggcggcagcgctcctaccgcttccaggccaggacccagtcggcc
ggaggaatcctgttcgagatggacgacttcgagaacttcgcccggatcgacgcggccctg
gcccgctcggcgccggaccggggagcgcccgtcgacctcagcctcggcgccgaccggggc
gttgtggccaaggacttcccaggccccgcgcgggccgaggtgggcaccctgagcgagcac
aaccagcgcgccttctaccggcgttgggccgagctgatgggggaactgccgtga

DBGET integrated database retrieval system