KEGG   Sinorhizobium meliloti 1021: SMc04256
Entry
SMc04256          CDS       T00058                                 

Name
(GenBank) Putative gentiobiose, salicin, and cellobiose ABC transporter, ATP-binding component
  KO
K10112  multiple sugar transport system ATP-binding protein [EC:7.5.2.-]
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMc04256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc04256
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Maltose/maltodextrin transporter
    SMc04256
   Maltose transporter
    SMc04256
   Arabinogalactan oligomer/maltooligosaccharide transport system
    SMc04256
   Raffinose/stachyose/melibiose transporter
    SMc04256
   Alpha-glucoside transporter
    SMc04256
   Glucose/mannose transporter
    SMc04256
   Trehalose/maltose transporter
    SMc04256
   Cellobiose transporter
    SMc04256
   N,N'-Diacetylchitobiose transporter
    SMc04256
   L-Arabinose/D-xylose transporter
    SMc04256
   Putative fructooligosaccharide transporter
    SMc04256
   Putative sorbitol/mannitol transporter
    SMc04256
   Arabinooligosaccharide transporter
    SMc04256
   Putative multiple sugar transporter
    SMc04256
SSDB
Motif
Pfam: ABC_tran OB_MalK TOBE_2 AAA_21 CysA_C_terminal RsgA_GTPase AAA_29 AAA_16 SMC_N AAA_23 ATPase_2 AAA_22 G-alpha NACHT Rad17 AAA_15 AAA_25 MMR_HSR1
Other DBs
NCBI-ProteinID: CAC46505
RhizoBase: SMc04256
UniProt: Q92P67
LinkDB
Position
complement(2084620..2085705)
AA seq 361 aa
MTSVSVRDLSLNFGAVTVLDRLNLDIDHGEFLVLLGSSGCGKSTLLNCIAGLLDVSDGQI
FIKDRNVTWEEPKDRGIGMVFQSYALYPQMTVEKNLSFGLKVAKIPPAEIEKRVKRASEI
LQIQPLLKRKPSELSGGQRQRVAIGRALVRDVDVFLFDEPLSNLDAKLRSELRVEIKRLH
QSLKNTMIYVTHDQIEALTLADRIAVMKSGVIQQLADPMTIYNAPENLFVAGFIGSPSMN
FFRGEVEPKDGRSFVRAGGIAFDVTAYPAHTRLQPGQKVVLGLRPEHVKVDEARDGEPTH
QAVVDIEEPMGADNLLWLTFAGQSMSVRIAGQRRYPPGSTVRLSFDMGVASIFDAESENR
L
NT seq 1086 nt   +upstreamnt  +downstreamnt
atgacaagcgtatctgtcagggacctgtcgttgaacttcggcgccgtcacagtgctcgac
aggctcaatctcgacatcgatcacggggagttcctcgtcctgctcggctcttccgggtgc
ggcaagtccacgctgctcaattgcattgccgggctgctcgacgtttccgacgggcagatc
ttcatcaaggaccgcaacgtcacctgggaggagccgaaggaccgcggcatcggcatggtg
tttcagtcctatgcgctctatccgcagatgaccgttgagaagaatctctccttcggcttg
aaagtcgccaagatcccgccggccgaaatcgaaaagcgcgtgaagcgggcctcggagatc
ctgcagatccagccgctgctcaagcgcaaaccttcggagctctccggcggtcagcggcag
cgcgtggcgatcggccgggcgctggtgcgcgatgtcgacgtcttcctgttcgacgagccg
ctgtcgaacctcgacgccaaactgcgctccgaactgcgcgtggagatcaagcgcctgcac
cagtcgctgaagaatacgatgatctacgtcacccatgaccagatcgaagcgctgacgctg
gccgaccggatcgccgtcatgaaaagcggcgtgatccagcaactcgccgatccgatgacg
atctataacgccccggagaacctcttcgtcgccggcttcatcggctcgccgtcgatgaat
ttcttccgcggcgaggtggagccgaaggatggacgcagtttcgttcgggccggcggcatc
gccttcgacgtgaccgcctatccggcgcataccaggctgcagccgggccagaaagtcgtt
ctcggcctgcggccggagcacgtgaaggtcgacgaggcgagggacggcgagccaacgcat
caggcggtcgtcgacatcgaggaaccgatgggggcggacaacctcctatggctgacattt
gccggccaatcgatgtcggtgcggattgccggccaaaggcgctacccgccgggaagcacg
gtgcgcctctccttcgacatgggcgtcgcgtcgattttcgacgccgagagtgaaaaccgc
ctctga

DBGET integrated database retrieval system