KEGG   Sinorhizobium meliloti 1021: SMc04259
Entry
SMc04259          CDS       T00058                                 

Name
(GenBank) Putative gentiobiose, salicin, and cellobiose ABC transporter, periplasmic solute-binding component
  KO
K17315  glucose/mannose transport system substrate-binding protein
Organism
sme  Sinorhizobium meliloti 1021
Pathway
sme02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sme00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    SMc04259
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sme02000]
    SMc04259
Transporters [BR:sme02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Glucose/mannose transporter
    SMc04259
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8
Other DBs
NCBI-ProteinID: CAC46508
RhizoBase: SMc04259
UniProt: Q92P64
LinkDB
Position
complement(2087747..2088982)
AA seq 411 aa
MNLRFLAAALGATAALPFGAASATDLEVTHWWTSGGEAAAVAELAKAFDATGNKWVDGAI
AGSGGTARPIMISRITGGDPMAATQFNHGRQAEELVQAGLMRDLTDIATKENWKEIVKPS
SLLDSCTIEGKIYCAPVNIHSWQWLWLSNAAFKQAGVEVPKNWDEFVAAAPALEKAGIVP
LAVGGQPWQANGAFDVLMVAIAGKENFEKVFAQKDEEVAAGPEIAKVFKAADDARRMSKG
TNVQDWNQATNMVITGKAGGQIMGDWAQGEFQLAGQKAGVDYTCLPGLGVNEVISTGGDA
FYFPLLEDEEKSKAQEVLASTLLKPETQVAFNLKKGSLPVRGDVDLAAANDCMKKGLDIL
AKGNVIQGTDQLLSADSQKQKEDLFSEFFANHSMTPEDAQKRFADIIAAAD
NT seq 1236 nt   +upstreamnt  +downstreamnt
atgaatttacgttttctagctgccgctttgggcgcaaccgctgccttgcccttcggcgct
gccagcgcgaccgatctcgaggtcacgcattggtggacttcgggtggagaggcggccgcg
gttgccgagcttgcgaaggctttcgacgcaaccggaaacaagtgggtcgacggcgcgatc
gccggctccgggggtacggcgcgcccgatcatgatcagccgcataaccggcggtgacccg
atggccgccacccagttcaaccatggccgtcaggcggaagagctggtgcaggcgggattg
atgcgcgatctcaccgatatcgccaccaaggaaaattggaaggaaatcgtgaagccgtcg
agcctgctcgactcctgcacgatcgaaggcaagatctattgcgcgccggtcaatatccac
tcctggcagtggctctggctttcgaacgccgccttcaaacaggcgggcgtcgaagttccg
aagaactgggacgagttcgtcgcagccgcaccggcgctcgagaaggccgggatcgttccg
ctcgccgtcggcggtcagccgtggcaggcgaacggcgccttcgacgtgctgatggtcgcg
atcgccggcaaggagaacttcgagaaggtcttcgcccagaaggatgaggaagtggcggcc
gggcctgaaatcgccaaagtcttcaaggctgcagacgatgcccgccgcatgtcgaagggc
accaacgtccaggattggaaccaggcgaccaacatggtcatcaccggcaaggccggcgga
cagatcatgggggactgggcccagggcgagttccagcttgcgggtcagaaagccggcgtg
gactacacctgccttccgggtctcggcgtcaacgaggtgatctcgaccggcggcgacgcg
ttctacttcccgcttctggaggatgaggaaaagtcgaaggcgcaggaagtgctggcgtcg
accctgctcaagccggaaacgcaggtggccttcaatctgaagaagggctctctgccggtg
cgcggggacgtcgatctcgcggccgcgaacgactgcatgaagaagggcctcgatatcctc
gccaagggcaatgtgatccagggcacggaccagcttctgtcggccgacagccagaagcag
aaagaggacctcttctccgagttcttcgcgaaccactccatgacgccggaagatgcgcag
aagcgtttcgccgacatcatcgccgctgcggattga

DBGET integrated database retrieval system